KEGG   Haloarcula hispanica ATCC 33960: HAH_2397Help
Entry
HAH_2397          CDS       T01597                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAH_2397 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_2397 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAH_2397 (trpA)
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HAH_2397 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2312911..2313792)
Genome map
AA seq 293 aa AA seqDB search
MGLERAFADEPAFVPYLAAGDPSYEASLEYVEALARGGADVIELGLPFSEPIAEGKTIQN
AIVRSLEAGMTPDRFFEFVEDLDVDVPLVCMTYYNLIYQYGEGDSESRSDSENASGETAS
QGPRPFVEKAAAVGIEGLVVPDLPAEEAAPLRQACDEFGLDLVFIVAPTTKGDRLERMLE
QVSGYVYVQARLGVTGAREDVDDATEESLARLSDWDVPKAVGFGIKTGDHAERIVSAGAD
GVIVGSALVDIVAEGHENGDPVDEVADRLEAKARELKDGALRGAAERPQPERT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcgaacgcgcctttgccgacgagcccgccttcgtcccgtacctcgcggccggc
gatccgagctacgaggcctcactggagtacgtcgaggcgctggcccgcggcggggcagac
gtcatcgaactcggcctgccgttctccgagccaatcgcggagggcaagaccatccagaac
gctatcgtccgctcgctggaagccgggatgacgcccgaccgcttcttcgagttcgtcgag
gatctcgacgtcgacgtgccgctggtgtgtatgacatactacaatctcatctatcagtat
ggtgagggagatagcgagtcgcgaagcgactcggaaaacgcgagcggtgaaaccgcgagc
cagggtccccgaccgttcgtcgagaaggccgccgcggtcggcatcgagggcctcgtcgtt
ccggacctgcccgccgaggaggctgccccgctccgccaggcctgcgacgagttcggtctc
gacctggtgttcatcgtcgcgccgacgacgaaaggcgaccgactcgaacggatgctcgaa
caggtgtcgggctacgtgtacgtccaggcgcgcctgggcgtcaccggcgcgcgcgaggac
gtggacgacgccaccgaggaatcgctggcccggctctcggactgggacgtgcccaaggcc
gtcgggttcggcatcaagacgggtgaccacgccgagcgaatcgtttctgccggcgctgac
ggtgttatcgtcggctccgcgctggtcgatatcgtggccgagggtcacgagaacggcgac
ccagtcgacgaagtggccgaccggctcgaagcgaaggctcgtgaactcaaagacggtgcg
ctccggggcgcggcagaacgaccgcaaccggaacgcacataa

DBGET integrated database retrieval system