KEGG   Haloarcula hispanica ATCC 33960: HAH_2398Help
Entry
HAH_2398          CDS       T01597                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00260  Glycine, serine and threonine metabolism
hhi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01130  Biosynthesis of antibiotics
hhi01230  Biosynthesis of amino acids
Module
hhi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_2398 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAH_2398 (trpB)
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HAH_2398 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEM57985
UniProt: G0HXI2
Position
I:complement(2313792..2315102)
Genome map
AA seq 436 aa AA seqDB search
MSTDDAHDPKFGEYGGQYVPEALMPAIEELTDAYQRYVLENEDGFMDEFRERLADFGGRP
TPLQYADQLSARYDTDVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHG
TATAMAAAHLDMPCEIYMGETDIARQRPNVFRMRINGSEVNPVTVGRGTLKEAISETMRD
WATTVENTHYVIGSIVGPHPFPKMVRDFQAVISEEAREQAIEKTGGLPDSVLACAGGGSN
TMGTFAHFVDDDGEPRSPEQSSDDEPRDRVDLYAVEAGGSSLQVDEEEGVAPNSATLSTG
DEGVLHGARTKLLQDSDGQIMESHSVSAGLDYAGVGPELAHLVDEDRVTPVNVDDDAALE
AFHRLSQDEGIIPALETAHAFGYLEEHHDEVGDTVIVNVSGRGDKDLETVIEETSKRDLD
IAPDMSIFERVGGGGL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgacgacgcacacgaccccaagttcggtgagtacggtggacagtacgtgccc
gaggcgctgatgccagctatcgaggagctgacagacgcctaccagcggtacgtgctcgaa
aacgaggacggcttcatggacgagttccgggagcggctggccgacttcggcggccgaccg
acgccgctacagtacgcggaccagctctcggcccggtacgacacggacgtgtatctcaag
cgcgaggatctgctgcatggcggcgcgcacaagctcaacaacgcgctgggccaggtgctg
ctggcgaagtacatgggcaaggagcgcatcatcgccgagacgggggccggccagcacggc
acggcgacggcgatggcggcggcccatctggacatgccctgtgagatctacatgggcgag
actgacatcgcgcgccagcgtcccaacgtgttccggatgcgcatcaacgggtccgaagtg
aatccggtgaccgtcggccgcggcacgctgaaggaggccatttccgagacgatgcgggac
tgggcgaccaccgtcgagaacacccactacgtcatcgggagcatcgtcgggccgcacccg
ttcccgaagatggttcgggacttccaggcggtcatctccgaggaggcccgcgagcaggcc
atcgagaagaccggcgggctgcccgattcggtcctcgcctgtgccggcggcgggtcgaac
acgatgggcacgtttgcccatttcgtcgacgatgacggggagccacgctccccggaacag
tcgagcgacgacgagccgcgagaccgtgtcgacctctacgccgtcgaggccggcggctcc
tcgctccaggtcgacgaggaggagggcgtcgcgcccaactccgccaccctctcgactggc
gacgagggcgttcttcacggtgcgcgcacgaagctcctgcaggactcggacggccagatc
atggaatcccactccgtgtccgcggggcttgactacgccggtgtcggcccggaactggcc
cacctcgtcgacgaggaccgcgtcacgccggtcaacgtcgacgacgacgcagcgctggag
gcgttccaccggctctcccaggacgagggtatcatcccggccctggagacggcccacgcc
ttcggctatctcgaagagcaccacgacgaggtcggtgacaccgtcatcgtcaacgtctcc
ggccgcggcgacaaggacctcgaaacggtcatcgaggagacgagcaagcgcgacctcgac
atcgcgccggacatgtccatcttcgagcgggtcggcggaggtggcctctga

DBGET integrated database retrieval system