KEGG   Haloarcula hispanica ATCC 33960: HAH_2399Help
Entry
HAH_2399          CDS       T01597                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01130  Biosynthesis of antibiotics
hhi01230  Biosynthesis of amino acids
Module
hhi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAH_2399 (trpC)
Enzymes [BR:hhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HAH_2399 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE FMN_dh His_biosynth ThiG NMO IMPDH PDZ DHO_dh
Motif
Other DBs
NCBI-ProteinID: AEM57986
UniProt: G0HXI3
Position
I:complement(2315099..2315914)
Genome map
AA seq 271 aa AA seqDB search
MDYSEEIAPAVQSILDAARERGGGGDRVSVTPRSLADAFEAAENAGRTPVIAEIKPTSPT
ADGERTDDPVDLARQMVAGGAAALSVLTEPDHFGGSAATLERVRDAVDVPVLRKDFVLHE
SQLDVVEADVVLLIVRFLEADGTDDLADLLTAARERGFQVLVETHTAAEVEKALGAGADI
IGVNNRDLAELEVDLGTFEAVAPEVPDGVTLIAESGIQTPDDVTRMRDAGADALLIGSAI
MDHDAATDVEANTRRLTDADTDAVETTTTDT
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggactacagtgaggagattgcaccagcggtccagtcgattctcgacgcggcgcgggag
cgcggtggcggcggagaccgggtctcggtgacaccccggtcgctggccgatgccttcgaa
gcggccgagaatgctgggcggacgccggtcatcgcggagatcaagcctacgagcccgacc
gcggacggtgagcggaccgacgacccggtcgacctcgctcgacagatggttgcgggcggc
gcagcggcgctgtccgtgctgaccgagccggaccacttcggcgggtcggcggcgacgctc
gaacgggtccgcgacgccgtcgacgtgcccgtcctgcggaaagacttcgtcctccacgag
agccagctggacgtcgtcgaagcggacgtcgtcctgctcatcgtccgctttctcgaagcg
gacgggaccgacgaccttgctgatctcctcacggccgcgcgcgagcgcggtttccaggtc
ctcgtggagacccacaccgcggcagaggtcgagaaagcacttggcgcgggcgcggacatc
atcggcgtcaacaaccgcgacctcgcggagctggaggtcgacctcggaacgttcgaagcc
gtcgcgcccgaagtcccggacggcgtcacactcattgcggaaagcggcatacagacgccg
gacgacgttacacggatgcgcgacgccggtgcggacgcgctgctgatcggctcggcgatc
atggaccacgacgcggcgacggacgtggaagcgaacacgcggcgactaacagatgcggac
actgatgcggttgaaacgacgactacagacacatga

DBGET integrated database retrieval system