KEGG   Haloarcula hispanica ATCC 33960: HAH_2437Help
Entry
HAH_2437          CDS       T01597                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hhi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2355548..2356351)
Genome map
AA seq 267 aa AA seqDB search
MLPGAGADRGAADYALVGAPLDASTSFRPGARFGPRRVRQFGQQFDDYDHRTDQHFTDCS
VYDHGDIGPTADVAEYLTFLQGTLSDFESEGAVPLVVGGEHTVSVAGVRALDPDVFVCLD
AHLDLRESYAGDEYSHATVTHHALSVADEAIVLGARTGSEAEWDRANEPDVTVVPPEDVA
DWSPAFDDERVYLSVDIDAADPGFAPGTGTPEPFGLDPREMHTVVRAVAPQTVGFDVVEV
NDRDDGQTATLAAKLLRAFVFAHADQR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccggtgcgggggccgaccgcggggcggccgactacgcgctcgtgggcgcgcca
ctcgacgcgtcgacgtcgtttcgccccggtgcacgctttggcccacgccgcgtccgccag
ttcggccagcagttcgacgattacgaccaccgcaccgaccagcacttcactgactgttcc
gtctacgatcacggcgacatcggccccacggccgacgttgccgagtacctcactttcctc
cagggcactctctcggatttcgagagcgagggggccgtcccgctcgtcgtcggcggcgaa
cacaccgtctctgtggccggcgtgcgtgcgctcgatccagacgtgttcgtctgtctggac
gcgcatctcgacctgcgcgaatcctacgccggcgacgagtactcccacgcgacggtgacc
caccacgcgctctcggtggctgacgaagcgattgtgctgggcgcacgcactggctcggaa
gccgaatgggaccgcgcgaacgaacccgacgtgaccgtcgtcccgcccgaggacgtggcc
gactggtcgcctgcgttcgacgacgagcgggtgtacctctcagtcgacatcgacgccgcc
gaccccgggttcgcgccgggcaccgggacgccggaaccgttcggcctcgacccgcgggag
atgcacaccgtggtccgagccgtcgcaccgcagaccgtcggcttcgacgtagtcgaggtc
aacgaccgcgacgacggtcagacggcgacgctggccgcgaaactcctccgggcgttcgtg
ttcgcccacgcggaccagcgctaa

DBGET integrated database retrieval system