KEGG   Haloarcula hispanica ATCC 33960: HAH_2726Help
Entry
HAH_2726          CDS       T01597                                 

Gene name
pcm3
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hhi  Haloarcula hispanica ATCC 33960
Brite
Enzymes [BR:hhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HAH_2726 (pcm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT GCD14 Methyltransf_25 Methyltransf_31 MTS RrnaAD CMAS DUF938 Fibrillarin Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AEM58311
UniProt: G0HRH1
Position
I:complement(2632580..2633203)
Genome map
AA seq 207 aa AA seqDB search
MADWGRKRSRLADRLRERVSDEAVLAAIASVPRHRFVPDDKRHDAYADRPLPIGSGQTVS
APHMVAIMSELLDLSPGDQVLEVGTGCGYHAAVTAELVGPENVYSVEYHASLADEARETL
EATGYGDVSVRADDGKEGWPDHAPYDRTYLTCAAPEFPAPLVDQTRTGGLLLAPIGDGRQ
RLIRAEKQADGTLDSEDHGGVRFVPLQ
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccgactggggccgaaaacggtcgcggctggccgaccgccttcgcgagcgtgtctcc
gacgaggccgttctcgcggcgatagcgtcggttccccgccaccggttcgttccggacgac
aagcgacacgacgcctacgccgaccgcccgctcccgatcgggtcaggtcagacggtttct
gcgccgcacatggttgcaatcatgtccgagttactggacctgtccccgggggatcaggtg
ttagaggtcggtacggggtgtgggtaccacgccgcggtgaccgccgaactggtcggcccc
gagaacgtctacagcgtggagtaccacgcatcgctggccgacgaagcacgggaaacgctg
gaagcgaccggctacggcgacgtttccgttcgcgccgacgacggcaaggaggggtggccc
gaccacgccccctacgatcggacgtatctcacatgtgccgcgccggagttccccgccccg
ctcgtcgaccagacccgcaccggtggtctcttgctggctccaatcggtgacgggcgacag
cgtctcatccgcgcggagaaacaggccgacggcacgctcgatagcgaggaccacggcggc
gttcgattcgtcccgctccagtag

DBGET integrated database retrieval system