KEGG   Haloarcula hispanica ATCC 33960: HAH_2803Help
Entry
HAH_2803          CDS       T01597                                 

Gene name
gapA2
Definition
glyceraldehyde 3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:hhi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hhi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hhi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2698474..2699478
Genome map
AA seq 334 aa AA seqDB search
MSEPVRVGLNGFGRIGRNVFRASLHNDNVEVVGINDVMDDSEIDYFAQYDTVMGELEGAS
VDDGVLTVEGTDFEAGIFHETDPTQLPWDDLDVDVAFEATGIFRTKEDASQHLDAGTDKV
LISAPPKGDEPVKQLVYGVNHDEYDGEDVVSNASCTTNSITPVAKVLDEEFGINAGQLTT
VHAYTGSQNLMDGPNGKPRRRRAAAENIIPTSTGAAQATTEVLPELEGKLDGMAIRVPVP
NGSITEFVVDLDDDVTESDVNAAFEEAAAGELEGVLGVTSDDVVSSDILGDPYSTQVDLQ
STNVVSGMTKILTWYDNEYGFSNRMLDVAEYITE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagccagtccgcgtcggcctcaacggcttcggccgtatcggccgcaacgtattc
cgcgcatcgttacacaacgacaacgtcgaagtcgtcggtatcaacgatgtgatggacgac
tcggaaatcgactacttcgcccagtacgacaccgtcatgggtgaactcgaaggggccagc
gtcgacgacggcgtcctcacggtcgaggggaccgacttcgaagcaggcatcttccacgaa
acagatcccacacagctcccgtgggacgacctcgatgtcgacgtggccttcgaggcgacc
ggcatcttccgcaccaaggaggacgcgagccagcatctcgacgccgggaccgacaaggtc
ctcatctccgccccgccgaagggcgacgagccggtcaagcagctcgtctacggcgtcaac
cacgacgagtacgacggcgaggatgtcgtctcgaacgcctcctgtacgaccaactccatc
acgccggtcgcgaaggtcctcgacgaggagttcggcatcaacgccggccagctaacgacg
gtccacgcctacaccggctcccagaacctgatggacggcccgaacggcaagccccgccgt
cgccgtgcggccgccgagaacatcatcccgacctcgaccggtgccgcgcaggcgaccacc
gaggtcctgcccgagcttgaaggcaaactcgacgggatggctatccgcgtcccggtgccg
aacggctccatcaccgagttcgttgtcgacctcgacgacgacgtgacggagagcgatgtc
aacgccgccttcgaggaggccgctgccggcgaactcgaaggcgtgctgggcgtcacgagc
gacgacgtcgtctcctcggacatcctcggggacccgtactccacgcaggtcgacctgcag
tcgacgaacgtcgtctccgggatgacgaagattctcacctggtacgacaacgagtacggc
ttctcgaaccggatgctcgacgtggccgagtacatcactgagtaa

DBGET integrated database retrieval system