KEGG   Haloarcula hispanica ATCC 33960: HAH_2869Help
Entry
HAH_2869          CDS       T01597                                 

Gene name
cofE
Definition
F420-0:gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    HAH_2869 (cofE)
Enzymes [BR:hhi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     HAH_2869 (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     HAH_2869 (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2762057..2762830
Genome map
AA seq 257 aa AA seqDB search
MEVFAVEGLPEVRPGDDVAGLLVEQADLRDDDVICVASTIVSKANGRGRSLSSYEPSARA
ERIAATIEDIAGEEKDPRMAQAILDECTEVLVEAPFILGVTEFGHITVNAGIDRSNVPGA
DLLLLPENPTAEAEAIRAGIREQAGVEPSVIVTDTSGRPFRLGQRGVALGWAGLPASRDW
RGEHDRDGRELEATVQAVVDELAAAANLVTGEGDGGTPVAVVRDFDFGDHAGSEQLFRDP
EKDVVRQALRDWSHVRD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcttcgcggtcgaagggttgcccgaggtccgccccggggacgacgtggcgggg
ctgctcgtcgagcaggccgacctccgggacgacgacgtgatctgtgtcgccagcactatc
gtttccaaggccaacggacgcggccggtcgctatcgtcgtacgagccgagcgcgcgtgcc
gagcgcatcgcggcgaccatcgaggacatcgccggtgaggagaaagacccgcgaatggca
caggcgattctcgatgagtgtactgaggtgctggtcgaagcccccttcatcctcggcgtg
acggagttcgggcatatcaccgtcaacgcgggcatcgaccgctcgaacgtgcccggcgcg
gacctcctcttgctccccgagaatccgacggccgaggccgaagccatccgtgctggcatc
cgcgaacaagcgggcgtcgaacccagcgttatcgtcaccgacacgtcggggcggccgttc
cgactcggccagcgcggcgtcgcactgggctgggccgggctccctgcctctcgggactgg
cggggcgaacacgaccgcgacggccgcgaactcgaagccaccgtccaggccgttgtcgac
gaactcgccgccgcggccaacctcgtcaccggcgaaggcgacggcggaacgcccgtcgca
gtcgtccgcgatttcgacttcggcgaccacgcgggcagcgagcaactgttccgcgacccg
gagaaggacgtagtcagacaagcactcagagactggtctcatgtacgcgattga

DBGET integrated database retrieval system