KEGG   Haloarcula hispanica ATCC 33960: HAH_2945Help
Entry
HAH_2945          CDS       T01597                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAH_2945 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_2945 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HAH_2945 (thrC2)
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HAH_2945 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2829963..2831027
Genome map
AA seq 354 aa AA seqDB search
MRTCSVCDREYPREEPWRCSCGAPLDYASQPLPDSRPAQFSRTSGVWDFADFLPMDERVS
LGEGWTPLVDAPGWDATFKLEYLHPTGSFKDRGAATVIAEALGVGADRVLEDSSGNAGLA
VASYAARAGLDAEIYVPASAKEAKVRRIERTGADVVPVEGSRESVTAACIDAVESGAGWY
ASHAWNPAFFAGTATAAYEIAAQRNWSVPDAVVTPLGHGTLFLGLYRGFRALEQAGWTDA
IPRILGTQAVGYSPIADEEGSTPDDAAANDLADGIHIRDPPRAQQVRHAIDETGGAAVAV
SAAATERERDRLSGAGFHVEPTCATATAALPQFRERGELQDGDDVVVALTGRND
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctgtagcgtctgcgaccgggagtacccccgtgaggaaccctggcggtgttcc
tgcggggctccgcttgattacgccagccagcccctgcccgacagccgaccggcgcagttc
tcgcgaaccagcggcgtctgggacttcgctgacttcctccccatggacgaacgggtcagt
ttaggcgagggctggacgccgctggtcgacgcgcccgggtgggacgccacgttcaaactg
gagtatctccacccgacggggagtttcaaggaccgcggcgcggcgacggtcatcgccgaa
gcgctcggagtcggagccgaccgcgtgctcgaagactcctcgggcaacgccgggctggca
gtcgcgtcctacgcggcacgggcgggcctggacgcggagatatacgtcccggcgagcgca
aaggaagcgaaggttcgccgcatcgaacggaccggagccgacgtggtcccggtcgagggg
agtagagagtccgtaaccgcggcctgtatcgacgccgtcgagagtggggcgggctggtac
gccagtcacgcctggaaccccgcgttcttcgccgggacggcgacggccgcctacgaaatc
gccgcccagagaaactggagcgtgccggacgccgtcgtcacaccgctcggtcacgggacg
ctgtttctcggcctctaccgcgggttccgggcactggagcaagctggatggacggacgct
atcccgcgtatactggggacgcaagcggtcgggtacagtcccatcgccgacgaggagggc
agtacaccggacgacgctgctgccaacgacctcgctgacgggatccacatccgcgacccg
ccgcgtgcccagcaagtacgacatgccatcgacgaaaccggcggtgccgccgtcgctgtc
tccgcggcggcaaccgagcgagagcgcgaccgactcagtggggcagggtttcacgtcgag
ccgacgtgtgcgacggcgacggctgcgctccctcagttcagagagcggggagaactccag
gacggtgacgacgtggttgttgcgttgaccggacggaacgactaa

DBGET integrated database retrieval system