KEGG   Haloarcula hispanica ATCC 33960: HAH_2952Help
Entry
HAH_2952          CDS       T01597                                 

Gene name
manB2
Definition
(GenBank) phosphoglucomutase/phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00010  Glycolysis / Gluconeogenesis
hhi00030  Pentose phosphate pathway
hhi00051  Fructose and mannose metabolism
hhi00052  Galactose metabolism
hhi00230  Purine metabolism
hhi00500  Starch and sucrose metabolism
hhi00520  Amino sugar and nucleotide sugar metabolism
hhi00521  Streptomycin biosynthesis
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01120  Microbial metabolism in diverse environments
hhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_2952 (manB2)
   00030 Pentose phosphate pathway
    HAH_2952 (manB2)
   00051 Fructose and mannose metabolism
    HAH_2952 (manB2)
   00052 Galactose metabolism
    HAH_2952 (manB2)
   00500 Starch and sucrose metabolism
    HAH_2952 (manB2)
   00520 Amino sugar and nucleotide sugar metabolism
    HAH_2952 (manB2)
  Nucleotide metabolism
   00230 Purine metabolism
    HAH_2952 (manB2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HAH_2952 (manB2)
Enzymes [BR:hhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HAH_2952 (manB2)
    5.4.2.8  phosphomannomutase
     HAH_2952 (manB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEM58526
UniProt: G0HTG0
Position
I:2835149..2836525
Genome map
AA seq 458 aa AA seqDB search
MQVFGSSGVRGVAGDELTPRYVRVAQAAGDVWRDDHDRVAIARDTRTTGRTFINAATSGL
TAVGFDVDRLGVVPTPGLQAYCERESVPGVMITASHNPAAYNGVKLIGADGVELTRDTLD
HVEQSLRDDTPTYADWETVGSDTAIASARRRYREQVLSAVDRDRIADADLTVVVDPGHGA
GSLTSPDLFRELGCEVHTVNTQPDGHFPGRDPEPVAENLGDLRAFVRATDADLGFAHDGD
ADRGMFVDETGTHIEGDAALAALAAAKIESGDGVVSAVNASQRLVDVVEDAGATLSLTPI
GSTYIVSRIRKLQDEGTHVAIAGEGNGGILFPDYRIARDGAFTAAKFLELVAERPASEVA
ADYDDYYNVRRNLEYETEDEREAMLEGIEAHANDATADLDTTDGYRLDYGDGWVLARPSG
TEPVVRVYAEARTLDRAEELAETMVRRATQQADTYSGR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgttcgggtcgagtggcgtccgaggtgtcgcgggcgatgagctgacaccgcgg
tacgtccgggttgcacaggccgccggggacgtctggcgtgacgaccacgaccgcgtcgcg
atcgcccgggatacgcggacgaccgggcggacgtttatcaacgccgcgacaagcgggctg
acggccgtcgggttcgacgtcgaccgcctcggcgtcgtgccgacaccggggttgcaggcc
tactgcgagcgtgagtcggtcccgggcgtgatgattaccgcgagtcacaatccggccgcg
tacaacggcgtgaagctcatcggcgcggacggcgtcgaactgacgcgggacacgctcgac
cacgtcgagcagtccctccgggacgacaccccgacctacgcggactgggagacagtcggg
tccgacaccgccatcgccagcgctcgccgccgctaccgcgagcaggtgctgtctgccgtc
gaccgcgaccgcatcgccgacgccgacctcactgtcgtcgtcgaccccggccacggcgct
ggctcgctgacgagccccgacctgttccgcgaactcggctgtgaggtccacactgtcaac
acccagcccgacggccacttccccggccgcgaccccgaacccgtcgccgagaacctcgga
gacctccgggcgttcgtccgcgcgaccgacgccgacctcggattcgcccacgacggcgac
gccgaccgcgggatgttcgtcgacgagaccggaacccatatcgaaggtgacgccgcactg
gccgcgctcgcggcggcgaaaatcgagtcgggcgacggcgtcgtctcggcggtcaacgcc
tcccagcggctggtcgacgtcgtcgaggacgccggcgcgaccctctcgctcacccccatc
ggctcgacgtacatcgtcagccgcatccgcaaactgcaggacgaggggacccacgtcgcg
attgccggcgaaggcaacggcggcatcctcttccccgactaccgcatcgccagagacggg
gcgttcaccgccgcgaagttcctcgaactcgtcgccgagcggcccgcgagcgaggtggcc
gcggactacgacgactactacaacgtccggcgaaacctcgaatacgagaccgaagacgag
cgcgaagcgatgctcgaaggcatcgaggcccacgcgaacgacgcgacggccgacctcgac
acgacggacggctatcgcctcgactacggcgacggttgggtgctcgcccgaccgtccggc
acggagcccgtcgtccgggtctacgccgaagcgcgcacgctcgaccgcgccgaagagctg
gccgaaacgatggtgaggcgagcaacccagcaggctgacacttacagcggccgataa

DBGET integrated database retrieval system