KEGG   Haloarcula hispanica ATCC 33960: HAH_2952Help
Entry
HAH_2952          CDS       T01597                                 

Gene name
manB2
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_2952 (manB2)
   00030 Pentose phosphate pathway
    HAH_2952 (manB2)
   00051 Fructose and mannose metabolism
    HAH_2952 (manB2)
   00052 Galactose metabolism
    HAH_2952 (manB2)
   00500 Starch and sucrose metabolism
    HAH_2952 (manB2)
   00520 Amino sugar and nucleotide sugar metabolism
    HAH_2952 (manB2)
  Nucleotide metabolism
   00230 Purine metabolism
    HAH_2952 (manB2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HAH_2952 (manB2)
Enzymes [BR:hhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HAH_2952 (manB2)
    5.4.2.8  phosphomannomutase
     HAH_2952 (manB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2835149..2836525
Genome map
AA seq 458 aa AA seqDB search
MQVFGSSGVRGVAGDELTPRYVRVAQAAGDVWRDDHDRVAIARDTRTTGRTFINAATSGL
TAVGFDVDRLGVVPTPGLQAYCERESVPGVMITASHNPAAYNGVKLIGADGVELTRDTLD
HVEQSLRDDTPTYADWETVGSDTAIASARRRYREQVLSAVDRDRIADADLTVVVDPGHGA
GSLTSPDLFRELGCEVHTVNTQPDGHFPGRDPEPVAENLGDLRAFVRATDADLGFAHDGD
ADRGMFVDETGTHIEGDAALAALAAAKIESGDGVVSAVNASQRLVDVVEDAGATLSLTPI
GSTYIVSRIRKLQDEGTHVAIAGEGNGGILFPDYRIARDGAFTAAKFLELVAERPASEVA
ADYDDYYNVRRNLEYETEDEREAMLEGIEAHANDATADLDTTDGYRLDYGDGWVLARPSG
TEPVVRVYAEARTLDRAEELAETMVRRATQQADTYSGR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgttcgggtcgagtggcgtccgaggtgtcgcgggcgatgagctgacaccgcgg
tacgtccgggttgcacaggccgccggggacgtctggcgtgacgaccacgaccgcgtcgcg
atcgcccgggatacgcggacgaccgggcggacgtttatcaacgccgcgacaagcgggctg
acggccgtcgggttcgacgtcgaccgcctcggcgtcgtgccgacaccggggttgcaggcc
tactgcgagcgtgagtcggtcccgggcgtgatgattaccgcgagtcacaatccggccgcg
tacaacggcgtgaagctcatcggcgcggacggcgtcgaactgacgcgggacacgctcgac
cacgtcgagcagtccctccgggacgacaccccgacctacgcggactgggagacagtcggg
tccgacaccgccatcgccagcgctcgccgccgctaccgcgagcaggtgctgtctgccgtc
gaccgcgaccgcatcgccgacgccgacctcactgtcgtcgtcgaccccggccacggcgct
ggctcgctgacgagccccgacctgttccgcgaactcggctgtgaggtccacactgtcaac
acccagcccgacggccacttccccggccgcgaccccgaacccgtcgccgagaacctcgga
gacctccgggcgttcgtccgcgcgaccgacgccgacctcggattcgcccacgacggcgac
gccgaccgcgggatgttcgtcgacgagaccggaacccatatcgaaggtgacgccgcactg
gccgcgctcgcggcggcgaaaatcgagtcgggcgacggcgtcgtctcggcggtcaacgcc
tcccagcggctggtcgacgtcgtcgaggacgccggcgcgaccctctcgctcacccccatc
ggctcgacgtacatcgtcagccgcatccgcaaactgcaggacgaggggacccacgtcgcg
attgccggcgaaggcaacggcggcatcctcttccccgactaccgcatcgccagagacggg
gcgttcaccgccgcgaagttcctcgaactcgtcgccgagcggcccgcgagcgaggtggcc
gcggactacgacgactactacaacgtccggcgaaacctcgaatacgagaccgaagacgag
cgcgaagcgatgctcgaaggcatcgaggcccacgcgaacgacgcgacggccgacctcgac
acgacggacggctatcgcctcgactacggcgacggttgggtgctcgcccgaccgtccggc
acggagcccgtcgtccgggtctacgccgaagcgcgcacgctcgaccgcgccgaagagctg
gccgaaacgatggtgaggcgagcaacccagcaggctgacacttacagcggccgataa

DBGET integrated database retrieval system