KEGG   Haloarcula hispanica ATCC 33960: HAH_3075Help
Entry
HAH_3075          CDS       T01597                                 

Gene name
thrC3
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hhi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hhi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hhi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2961454..2962845)
Genome map
AA seq 463 aa AA seqDB search
MVPTMADLQLTDDVPPVADDGVWLACIECGETFAPFDAIRYTCDDCDGLLEVRYDDLPTF
DEFDGSGVWRYNAALPFEEGVTLPEGDTPLHEMPRLKDDIGVDALRVKHEGMNPTGSFKD
RGMTVGVRVAQEVGVDRLACASTGNTSAALAAYGARGGMETLVLLPAGKVAAGKIAQASL
HRARILEVDGNFDQCLDIVQDLAQRGEAYLLNSLNPFRLEGQKTIGLEIMEEFYADHGEY
PDRIVLPVGNAGNTAALYKCFRELVKAGAITEEQVPKLTGVQAEGAAPMVEAIENGYEDT
RRWEDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDEEITEAQRDIAGEGVGVEPA
SAASVAGLRKLRREGEVDSDESVVCLTTGHLLKDPEAAAEAGNEPEPVENSTEAVLDLIE
EPSSVAQTVRRQASKAADAPLVPALVASGLGVAYLYRKLRSKK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgacaatggctgacctgcaactcaccgacgacgtgccgccggttgccgacgac
ggcgtctggctggcctgcatcgagtgtggtgagacgttcgctcccttcgacgcgattcgc
tacacctgcgacgactgtgacggcctgcttgaagtccgctacgacgacctgccgaccttc
gacgagttcgatggctcgggggtctggcggtacaacgctgccctgcccttcgaagagggt
gtcacgctccccgagggtgacacgccgctgcacgagatgccgcgcctgaaagacgacatc
ggcgtggacgcgctccgcgtgaaacacgaggggatgaaccccactggctcgttcaaggac
cgcggcatgaccgtcggtgtccgggtcgcccaagaggtcggcgtcgaccgactggcctgt
gcctcgacgggcaacacgtctgcggcactggcggcttacggcgctcgcggcgggatggag
acgctcgtgctcctgcctgccgggaaggtcgcagccggcaaaatcgcacaggcgagcctc
catcgcgcgcgcatcctcgaagtcgacggcaacttcgaccagtgtctcgacatcgtgcag
gacctcgcacagcgcggtgaggcgtacctgctgaactccctgaaccccttccgcctggaa
ggccagaagaccatcgggctggagatcatggaggagttctacgccgaccacggcgagtac
ccggaccgcatcgtcctgccggtcggcaacgccggcaacaccgcggcgctgtacaagtgc
ttccgcgaactcgtcaaggccggcgcaatcaccgaggagcaggtgcccaaactcaccggc
gtgcaggcagagggtgccgctccgatggtcgaggctatcgagaatggatacgaggacacc
cgccgctgggaggacgtcgagacccgcgcgaccgccatccgcatcggcaatccggtcaac
gcgccgaaggcgctgccgggcatccgggagaccggcggcaccgccgtcgctgtctctgac
gaagagatcaccgaagcgcagcgcgacatcgccggggaaggcgtcggcgtcgaaccggct
tccgcggcctccgtcgccggcctccggaaactccggcgcgagggcgaggtcgatagcgac
gagtcggtcgtctgcctgaccacgggccacctgctcaaagaccccgaggcggccgctgag
gccgggaacgagccggagccggtcgaaaacagcaccgaagccgtgctggacctcatcgaa
gaaccgtcgtcggtcgcccagacggttcggcgacaggcgtcgaaggccgccgacgcgccg
ctggtcccggcgctggtcgccagcggtctcggtgtcgcgtatctctaccgcaaactccgc
tcgaagaagtaa

DBGET integrated database retrieval system