KEGG   Haloarcula hispanica ATCC 33960: HAH_4339Help
Entry
HAH_4339          CDS       T01597                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase/glycoside hydrolase family 3 domain-containing protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HAH_4339 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HAH_4339 (nagZ)
Enzymes [BR:hhi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HAH_4339 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:332461..334032
Genome map
AA seq 523 aa AA seqDB search
MQTQTVASMPLTQKVGQLFMAGFDGTEPTAGIRELIREYNLGNIIYFTRNITSPAQVAAL
SAELQSEATAVGAGLPLFVATDQEGGVVSRLNWGTQLPSQMLIGACDDEAMARKAGATVG
RELRSLGINLNLAPVLDVNNNPDNPVIGVRSFGENPERVAALGAAMAQGLQSVAVAACGK
HFPGHGDTAVDSHLDLPVVAHERSRLERVEFAPFEAAIQSGIDAIMTTHVAFPAITGDAE
LPATISSAVQTALLRKQLGFDGLLVTDCLEMDAIAEGVGPAEGAVRAIEAGCDIVTVSHT
LERQRAAIEAVLTAVRTGRLTEERIDRSLQRIRRCKQQRIGASETAEKPEWNRCAPESKQ
LATEIANCGVTLVRDDSETVPFDTSRHLHVVSFTGTRGSPAEDERYDPEAVSAALSEVGF
EITTHTVATGETVEIAAENEQIVAVSYDALANESQAATLRTLIAHHDQLAVLAVRNPYDL
SVCPDAATFLTTYGYSPGAIQAAAKTLAGTVDPTGTLPVTIPD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcagactcagacggtggcgagtatgccattaacacagaaagtcggccagttattcatg
gctggctttgatggcaccgaaccgactgctgggatacgggaactgattcgtgagtacaac
ctcggcaacatcatttatttcacccgaaatattacgtcgccggcgcaggtggcagccctc
tcggcggagttgcagtcagaagccacagcagtcggcgctggcctcccactgttcgtcgcc
accgaccaggagggcggcgtcgtctcacgcctcaactggggcacgcaactgccgagtcag
atgctcattggggcctgcgatgacgaagcgatggctcggaaagcaggtgcgaccgtcgga
cgggagctacggagcctcgggatcaatctgaacctcgcgccagtcctcgacgtcaacaac
aacccggacaaccccgtaatcggtgtcagatccttcggtgaaaatcccgagcgcgtggcc
gcgctgggcgcagccatggcccagggcctccagtccgtggctgtcgcggcctgtgggaag
catttccccggtcatggcgacacggcagtcgattcacatctcgacctgccggtggtcgcc
cacgagcggtcccgactggaacgcgtggagttcgcaccgttcgaagcggcgatacagagc
ggtatcgacgcgatcatgaccacacacgttgcctttccggcgataacaggcgacgcggaa
ctgccagcgacgatatcgtcggcagtccagacagcactgcttcgaaagcaattggggttt
gatgggttactcgtcacggactgtctcgagatggacgcgattgccgaaggcgtcggtccc
gccgaaggggctgtccgtgcaatcgaggccgggtgtgatatcgtcactgtttcacatacg
ctcgagcgacagcgtgcagcgattgaggccgtgcttaccgccgtccgaacgggacggctt
accgaggagcgaatcgaccggtcgctgcagcgcatccggcgttgtaaacagcaacggata
ggtgcatctgagactgccgaaaagccggagtggaatcgctgtgcgcccgaatcgaaacag
cttgcaactgaaatcgcaaactgtggggtaacactcgtcagggacgacagcgagacagtg
ccgttcgatacgtcgcgtcacctgcatgtggtcagctttaccggaacgcgggggtcgccc
gccgaggacgagcgctacgacccagaggcggtctctgctgcgctcagcgaggtcgggttt
gaaatcacgacccatacagtggcgaccggtgagactgtcgagatagcggcagagaacgag
cagattgtcgctgtcagttacgatgccctggcaaacgagtcacaggcagcgacgctccgg
acgctcattgcgcaccacgaccagctggcagtccttgccgtacggaacccatacgacctc
tctgtctgtccagatgcggccacgtttttgacgacctacggctactcaccaggtgcgatt
caggcagcggcgaaaacactggcagggacagtcgacccaacggggacgcttccggtcacg
attcccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system