KEGG   Haloarcula hispanica ATCC 33960: HAH_4375Help
Entry
HAH_4375          CDS       T01597                                 

Gene name
acs6
Definition
(RefSeq) acyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_4375 (acs6)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_4375 (acs6)
   00620 Pyruvate metabolism
    HAH_4375 (acs6)
   00640 Propanoate metabolism
    HAH_4375 (acs6)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_4375 (acs6)
   00680 Methane metabolism
    HAH_4375 (acs6)
Enzymes [BR:hhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HAH_4375 (acs6)
Lipid biosynthesis proteins [BR:hhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HAH_4375 (acs6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(371172..372854)
Genome map
AA seq 560 aa AA seqDB search
MVTSHNLPDYDTARNEFSWDDIYAAADWDAPNELNIGHEVADRHATDRGQVALYQVGTDG
ELSKMTFWELADRSSQFANVLDDLGVAQGDRVFSYMPRIPEHYVALVGTLKHGAVWGSVN
ERFGPDGISYRLDDCDAKVVVTTTDNRDTVEDALDEAPSVEHVLTVDRGGGAPADDVVFN
TALDGASTAYEVAETSGEDDALLYYTSGTTGLAKGVLHKQRWIAGVAATQKYAVDLQDGD
LYWSTGDLGWLTGAINTLGAWFWGASLFTYEGEFDTDEWAALLDEYPISVLFSVPTAYRM
LRENEEVLADVDLDLRHALSIGEPLSAGVVEWGEDELGVTILDTYGQTETGNMIINNYPT
MDLRPGSMGKPLPGIEADIVDPQSGEVLEPGETGEIAQRGDYPCFFAEFWNKPEKTQRAF
IDGPDGKWYLSGDLAHKDEDGYFWFEGRADDVILSAGYRIGPFEVESSLGEHDAVAEAAV
VPKPHEARGNIVKAYVVPSEDAEPSASLKEDIQSYVKEELSAHEYPREIEFREGLPKTVT
GKIRRTELHDDAEAEAEVES
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccagccacaacctcccggactacgacacagcgcgaaacgagttctcctgggac
gatatatacgcggcagcggactgggacgcaccaaacgagctgaacatcgggcacgaagtc
gccgaccgtcacgcgaccgaccggggccaggtcgcactctaccaggtcgggaccgacgga
gagctgtcgaaaatgacgttctgggagcttgctgaccgttcgagccagttcgccaacgtt
ctcgacgacctcggggtcgcccagggtgaccgggtcttttcatacatgccccggattccg
gagcactacgtggcgctggtcggcacgctcaaacacggtgccgtctggggaagtgtcaac
gagcggttcggccccgacggcatctcgtaccgtctggacgactgcgacgcgaaggtcgtc
gtcaccacgaccgacaatcgcgacacggtcgaagacgcgctggacgaggccccgtcggtc
gaacacgtactcaccgttgaccgcgggggcggcgcacccgctgacgacgtggtgttcaat
accgcgcttgatggcgcgagcacggcgtacgaggtcgctgagaccagcggggaagacgac
gcgctgctgtactacacttcgggaacgaccgggctggccaagggtgtcctccacaaacag
cgctggatcgccggcgtcgcggcaacacagaagtacgccgtggaccttcaagacggcgac
ctgtactggtcgaccggtgacctcggctggctgacgggtgcaatcaacaccctcggtgcc
tggttctggggtgcgtcgctgttcacgtacgaaggcgagttcgacaccgacgagtgggcc
gccctgctcgacgaatacccgattagcgtcctgttctcggttccgacggcgtaccggatg
ctccgggagaacgaggaggtccttgcggatgtcgacctcgatttgcggcatgcgctttcc
atcggcgaaccgctcagcgccggcgtcgtcgagtggggagaagacgaactcggcgtcacg
attctggatacgtacggccagactgagaccgggaacatgatcatcaacaactatccaacg
atggacctccggcccgggtcgatggggaaaccactccccggaatcgaggccgacatcgtc
gacccacagagcggcgaggttctggaacccggtgagacgggcgaaatcgcacagcgcggc
gactacccgtgtttcttcgccgagttctggaacaagcccgagaagacccagcgggcattt
atcgacggtccagacgggaaatggtatctctcgggtgatctggcacacaaagacgaggac
ggctacttctggttcgaggggcgtgcggacgacgtgatcctctctgctggctaccgcatc
gggccgttcgaggtcgagagttcgctgggtgaacacgacgcggtcgccgaggcggcagtc
gtccccaaaccacacgaggcgcgagggaacatcgtcaaggcctatgtcgtgccgagcgag
gacgctgagccatccgcctcgctcaaagaagacatccagagctacgtgaaagaagagctc
tcagcacacgagtacccgcgcgaaatcgagttccgggagggcctacccaaaacagtgacc
gggaaaattcgccgaaccgaactccacgacgacgccgaagcagaagccgaagtcgaatcc
tga

DBGET integrated database retrieval system