KEGG   Haloarcula hispanica ATCC 33960: HAH_4375Help
Entry
HAH_4375          CDS       T01597                                 

Gene name
acs6
Definition
acyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_4375 (acs6)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_4375 (acs6)
   00620 Pyruvate metabolism
    HAH_4375 (acs6)
   00640 Propanoate metabolism
    HAH_4375 (acs6)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_4375 (acs6)
   00680 Methane metabolism
    HAH_4375 (acs6)
Enzymes [BR:hhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HAH_4375 (acs6)
Lipid biosynthesis proteins [BR:hhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HAH_4375 (acs6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(371172..372854)
Genome map
AA seq 560 aa AA seqDB search
MVTSHNLPDYDTARNEFSWDDIYAAADWDAPNELNIGHEVADRHATDRGQVALYQVGTDG
ELSKMTFWELADRSSQFANVLDDLGVAQGDRVFSYMPRIPEHYVALVGTLKHGAVWGSVN
ERFGPDGISYRLDDCDAKVVVTTTDNRDTVEDALDEAPSVEHVLTVDRGGGAPADDVVFN
TALDGASTAYEVAETSGEDDALLYYTSGTTGLAKGVLHKQRWIAGVAATQKYAVDLQDGD
LYWSTGDLGWLTGAINTLGAWFWGASLFTYEGEFDTDEWAALLDEYPISVLFSVPTAYRM
LRENEEVLADVDLDLRHALSIGEPLSAGVVEWGEDELGVTILDTYGQTETGNMIINNYPT
MDLRPGSMGKPLPGIEADIVDPQSGEVLEPGETGEIAQRGDYPCFFAEFWNKPEKTQRAF
IDGPDGKWYLSGDLAHKDEDGYFWFEGRADDVILSAGYRIGPFEVESSLGEHDAVAEAAV
VPKPHEARGNIVKAYVVPSEDAEPSASLKEDIQSYVKEELSAHEYPREIEFREGLPKTVT
GKIRRTELHDDAEAEAEVES
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccagccacaacctcccggactacgacacagcgcgaaacgagttctcctgggac
gatatatacgcggcagcggactgggacgcaccaaacgagctgaacatcgggcacgaagtc
gccgaccgtcacgcgaccgaccggggccaggtcgcactctaccaggtcgggaccgacgga
gagctgtcgaaaatgacgttctgggagcttgctgaccgttcgagccagttcgccaacgtt
ctcgacgacctcggggtcgcccagggtgaccgggtcttttcatacatgccccggattccg
gagcactacgtggcgctggtcggcacgctcaaacacggtgccgtctggggaagtgtcaac
gagcggttcggccccgacggcatctcgtaccgtctggacgactgcgacgcgaaggtcgtc
gtcaccacgaccgacaatcgcgacacggtcgaagacgcgctggacgaggccccgtcggtc
gaacacgtactcaccgttgaccgcgggggcggcgcacccgctgacgacgtggtgttcaat
accgcgcttgatggcgcgagcacggcgtacgaggtcgctgagaccagcggggaagacgac
gcgctgctgtactacacttcgggaacgaccgggctggccaagggtgtcctccacaaacag
cgctggatcgccggcgtcgcggcaacacagaagtacgccgtggaccttcaagacggcgac
ctgtactggtcgaccggtgacctcggctggctgacgggtgcaatcaacaccctcggtgcc
tggttctggggtgcgtcgctgttcacgtacgaaggcgagttcgacaccgacgagtgggcc
gccctgctcgacgaatacccgattagcgtcctgttctcggttccgacggcgtaccggatg
ctccgggagaacgaggaggtccttgcggatgtcgacctcgatttgcggcatgcgctttcc
atcggcgaaccgctcagcgccggcgtcgtcgagtggggagaagacgaactcggcgtcacg
attctggatacgtacggccagactgagaccgggaacatgatcatcaacaactatccaacg
atggacctccggcccgggtcgatggggaaaccactccccggaatcgaggccgacatcgtc
gacccacagagcggcgaggttctggaacccggtgagacgggcgaaatcgcacagcgcggc
gactacccgtgtttcttcgccgagttctggaacaagcccgagaagacccagcgggcattt
atcgacggtccagacgggaaatggtatctctcgggtgatctggcacacaaagacgaggac
ggctacttctggttcgaggggcgtgcggacgacgtgatcctctctgctggctaccgcatc
gggccgttcgaggtcgagagttcgctgggtgaacacgacgcggtcgccgaggcggcagtc
gtccccaaaccacacgaggcgcgagggaacatcgtcaaggcctatgtcgtgccgagcgag
gacgctgagccatccgcctcgctcaaagaagacatccagagctacgtgaaagaagagctc
tcagcacacgagtacccgcgcgaaatcgagttccgggagggcctacccaaaacagtgacc
gggaaaattcgccgaaccgaactccacgacgacgccgaagcagaagccgaagtcgaatcc
tga

DBGET integrated database retrieval system