KEGG   Haloarcula hispanica ATCC 33960: HAH_5142Help
Entry
HAH_5142          CDS       T01597                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hhi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHH400:complement(149623..150276)
Genome map
AA seq 217 aa AA seqDB search
MTDQDIAHYETRTAICEYGRSLLEDDLTTGTGGNLSARLDENHIAISPSGIPYEEIEPED
VPVVRMDGTVVEGDVEPSTELPMHLAVYRERPAVGGVVHTHSPYATTFASLGEAIPASHY
LLSFTGTEVPVAEYRTHATEELGEAAVDALGESFNATLLRNHGVLTADESLDDAYTVALM
VEYCARIHHQARAIGEPEILPDEEIDRLADKLDSYGQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcaagacattgcacactacgagacgcgaaccgctatctgcgagtacggccgg
agcctgctcgaagacgatctgacaaccgggaccggtggaaacctgagtgcccgactcgac
gagaaccacatcgcgatcagcccgtcgggaatcccctacgaggagatcgaaccggaagac
gttcctgttgtacggatggatggcactgtcgttgagggcgacgtcgagccgtcgacggag
ctaccgatgcatctggcggtctaccgcgagcggcccgcggtcggtggcgtcgtccacacc
cactcgccgtacgcgacgacgtttgcctcgctcggggaggcgattcccgcctcccactac
ctcctctcgtttaccgggacggaggtccccgtcgccgaataccggacgcacgcgaccgaa
gaactcggcgaagcggccgtcgacgcgctgggcgagtcgttcaacgccacgctgttgcgc
aaccacggcgtgctgaccgccgacgagtcgctggacgacgcctacacggtcgcgttgatg
gtcgagtactgcgcccgcatccaccatcaggcccgggccatcggcgagccggagatcctc
ccggacgaggagatcgaccggctggccgataagctcgacagctacggacagtga

DBGET integrated database retrieval system