KEGG   Haloarcula hispanica ATCC 33960: HAH_5297Help
Entry
HAH_5297          CDS       T01597                                 

Gene name
thrC4
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00260  Glycine, serine and threonine metabolism
hhi00750  Vitamin B6 metabolism
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01120  Microbial metabolism in diverse environments
hhi01230  Biosynthesis of amino acids
Module
hhi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_5297 (thrC4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HAH_5297 (thrC4)
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HAH_5297 (thrC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEM59430
UniProt: G0I0K9
Position
pHH400:326506..327720
Genome map
AA seq 404 aa AA seqDB search
MEYDPNQIIYTCPEHEGVKGILEVTYDYDAIDDAFDGDLGGPISSQWKYEAFLPVAADAD
VVTLNEGGTDLFDAPNLSDALGVETLVKDDGRNPTGCFKDRASAIAVTKAKHAGRDIITC
ASTGNAAASLSGYAARGGMDCRIFVPGDAPTGKLAQPLVYGADVLAVNGSYDEAYDLSVE
VTEKYGWYNRNAAINPFQVEGKRTVGHELADQSIARGHVPDWVVFSMGDGCTIAGAWKGF
KEFYDLGYVDDHPQMLGVQADGASAIHDAFHDHDDIDDIAETLADSIAVGRPRNTLKACR
ALEQSGGTSVLVSDDEILAAEKLLGSTEGIYSEPAGAAPIAGVQTALDRGIIEQDETVVV
VSTGFGLKDTKSAEKATGGVDRIDPDIAEVEGLYGTAEEAAADD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagtacgacccgaaccagatcatctacacctgtcccgaacacgagggcgtaaaggga
attctcgaagtgacatacgactacgatgctatcgacgacgcgttcgatggcgacctcggc
gggccgatatcgagccagtggaagtacgaggcgtttctgccagtcgcagcggacgccgat
gtcgtgacgctcaacgagggcgggaccgacctcttcgacgcaccgaacctcagcgatgcc
ctgggggtcgaaacgcttgtcaaagacgacggacggaacccgacggggtgtttcaaggac
cgcgccagcgctatcgctgtcacgaaggccaaacacgccggtcgagacatcatcacctgc
gcctcgaccgggaacgccgccgcgtcgctgtcgggctatgccgcccgcggggggatggac
tgtcgaatcttcgtccccggtgacgctccgacaggcaagctcgcacagccgctcgtctac
ggtgcggacgtcctcgctgtcaacggcagctacgacgaagcctacgacctcagcgtcgaa
gtcaccgagaagtacggctggtacaaccgcaacgcggccatcaatccgttccaggtcgag
ggcaagcggacggttggtcacgaactcgccgaccagtcgattgctcgcggacacgtcccg
gactgggtcgtgttctcgatgggcgacggctgtacgatcgccggggcctggaaggggttc
aaggagttctacgacctcggctacgtcgacgaccacccccagatgctgggcgtccaggcc
gacggtgcgtcggccatccacgacgccttccacgaccacgacgatatcgacgatatcgcc
gaaacgctggccgactcaatcgcggtcgggcggccgcggaacacgctcaaggcctgccgc
gcgctggaacagagcggcggaacgagcgtgctggtctccgacgacgagattctggcggca
gagaaactgcttggcagcaccgagggaatctactccgaaccggctggcgcggcacctatc
gccggcgtccagaccgcgctcgaccgtgggatcatcgagcaggacgaaaccgtcgtcgtg
gtatctaccggcttcggcctgaaggacacgaaaagcgccgagaaggcaaccggcggggtc
gaccgaatcgaccccgacatcgcggaagtcgaaggcctgtacggcacggccgaggaagcc
gcggccgacgattga

DBGET integrated database retrieval system