KEGG   Haloarcula hispanica ATCC 33960: HAH_5297Help
Entry
HAH_5297          CDS       T01597                                 

Gene name
thrC4
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAH_5297 (thrC4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_5297 (thrC4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HAH_5297 (thrC4)
Enzymes [BR:hhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HAH_5297 (thrC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHH400:326506..327720
Genome map
AA seq 404 aa AA seqDB search
MEYDPNQIIYTCPEHEGVKGILEVTYDYDAIDDAFDGDLGGPISSQWKYEAFLPVAADAD
VVTLNEGGTDLFDAPNLSDALGVETLVKDDGRNPTGCFKDRASAIAVTKAKHAGRDIITC
ASTGNAAASLSGYAARGGMDCRIFVPGDAPTGKLAQPLVYGADVLAVNGSYDEAYDLSVE
VTEKYGWYNRNAAINPFQVEGKRTVGHELADQSIARGHVPDWVVFSMGDGCTIAGAWKGF
KEFYDLGYVDDHPQMLGVQADGASAIHDAFHDHDDIDDIAETLADSIAVGRPRNTLKACR
ALEQSGGTSVLVSDDEILAAEKLLGSTEGIYSEPAGAAPIAGVQTALDRGIIEQDETVVV
VSTGFGLKDTKSAEKATGGVDRIDPDIAEVEGLYGTAEEAAADD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagtacgacccgaaccagatcatctacacctgtcccgaacacgagggcgtaaaggga
attctcgaagtgacatacgactacgatgctatcgacgacgcgttcgatggcgacctcggc
gggccgatatcgagccagtggaagtacgaggcgtttctgccagtcgcagcggacgccgat
gtcgtgacgctcaacgagggcgggaccgacctcttcgacgcaccgaacctcagcgatgcc
ctgggggtcgaaacgcttgtcaaagacgacggacggaacccgacggggtgtttcaaggac
cgcgccagcgctatcgctgtcacgaaggccaaacacgccggtcgagacatcatcacctgc
gcctcgaccgggaacgccgccgcgtcgctgtcgggctatgccgcccgcggggggatggac
tgtcgaatcttcgtccccggtgacgctccgacaggcaagctcgcacagccgctcgtctac
ggtgcggacgtcctcgctgtcaacggcagctacgacgaagcctacgacctcagcgtcgaa
gtcaccgagaagtacggctggtacaaccgcaacgcggccatcaatccgttccaggtcgag
ggcaagcggacggttggtcacgaactcgccgaccagtcgattgctcgcggacacgtcccg
gactgggtcgtgttctcgatgggcgacggctgtacgatcgccggggcctggaaggggttc
aaggagttctacgacctcggctacgtcgacgaccacccccagatgctgggcgtccaggcc
gacggtgcgtcggccatccacgacgccttccacgaccacgacgatatcgacgatatcgcc
gaaacgctggccgactcaatcgcggtcgggcggccgcggaacacgctcaaggcctgccgc
gcgctggaacagagcggcggaacgagcgtgctggtctccgacgacgagattctggcggca
gagaaactgcttggcagcaccgagggaatctactccgaaccggctggcgcggcacctatc
gccggcgtccagaccgcgctcgaccgtgggatcatcgagcaggacgaaaccgtcgtcgtg
gtatctaccggcttcggcctgaaggacacgaaaagcgccgagaaggcaaccggcggggtc
gaccgaatcgaccccgacatcgcggaagtcgaaggcctgtacggcacggccgaggaagcc
gcggccgacgattga

DBGET integrated database retrieval system