KEGG   Halobacteroides halobius: Halha_0051Help
Entry
Halha_0051        CDS       T02401                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hhl  Halobacteroides halobius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halha_0051
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_0051
   00020 Citrate cycle (TCA cycle)
    Halha_0051
   00620 Pyruvate metabolism
    Halha_0051
   00640 Propanoate metabolism
    Halha_0051
   00650 Butanoate metabolism
    Halha_0051
  Energy metabolism
   00680 Methane metabolism
    Halha_0051
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Halha_0051
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Halha_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
47569..48141
Genome map
AA seq 190 aa AA seqDB search
MASLTEIRWHGRGGQGAKTASILLGKVAAKTGKHIQAFPEYGPERMGAPVLAYNRISEDD
ITVHCQVTDPGIVTVLDPTLLNVVDVTDGVPEDGTLVVNSEEDVATIKEQLEFDGDIWVL
DAYGVANKEIGRPFPNTPMLGALMQATDLLPFENFVKQIKVELEKKFAHKPEMIDKNVAA
IKRAYKEVAK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcttaactgaaattcgttggcatggtagaggtggacaaggagctaagactgct
tctattttattaggtaaagttgctgctaagactggtaagcatattcaggcctttcctgag
tatggcccagagagaatgggggctccagtattagcctataatcgaattagtgaagatgat
attacagttcactgtcaggtaacagatcctggcattgttactgtattagatccaacgtta
ttaaatgttgtagatgttacagatggtgttccggaggatggaacactagtagttaattct
gaagaggatgtagcaacaattaaggaacaattagaatttgatggggatatttgggtgctg
gatgcgtatggcgttgctaataaggaaattggacgtccatttcccaatactccaatgtta
ggtgctttaatgcaagctactgatttattaccattcgaaaattttgttaaacaaattaag
gttgaattagagaagaagtttgcccataagcctgaaatgattgataagaatgttgctgca
attaaacgggcttataaggaggtggccaagtaa

DBGET integrated database retrieval system