KEGG   Halobacteroides halobius: Halha_0051Help
Entry
Halha_0051        CDS       T02401                                 

Definition
2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hhl  Halobacteroides halobius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halha_0051
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_0051
   00020 Citrate cycle (TCA cycle)
    Halha_0051
   00620 Pyruvate metabolism
    Halha_0051
   00640 Propanoate metabolism
    Halha_0051
   00650 Butanoate metabolism
    Halha_0051
  Energy metabolism
   00680 Methane metabolism
    Halha_0051
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Halha_0051
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Halha_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47569..48141
Genome map
AA seq 190 aa AA seqDB search
MASLTEIRWHGRGGQGAKTASILLGKVAAKTGKHIQAFPEYGPERMGAPVLAYNRISEDD
ITVHCQVTDPGIVTVLDPTLLNVVDVTDGVPEDGTLVVNSEEDVATIKEQLEFDGDIWVL
DAYGVANKEIGRPFPNTPMLGALMQATDLLPFENFVKQIKVELEKKFAHKPEMIDKNVAA
IKRAYKEVAK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcttaactgaaattcgttggcatggtagaggtggacaaggagctaagactgct
tctattttattaggtaaagttgctgctaagactggtaagcatattcaggcctttcctgag
tatggcccagagagaatgggggctccagtattagcctataatcgaattagtgaagatgat
attacagttcactgtcaggtaacagatcctggcattgttactgtattagatccaacgtta
ttaaatgttgtagatgttacagatggtgttccggaggatggaacactagtagttaattct
gaagaggatgtagcaacaattaaggaacaattagaatttgatggggatatttgggtgctg
gatgcgtatggcgttgctaataaggaaattggacgtccatttcccaatactccaatgtta
ggtgctttaatgcaagctactgatttattaccattcgaaaattttgttaaacaaattaag
gttgaattagagaagaagtttgcccataagcctgaaatgattgataagaatgttgctgca
attaaacgggcttataaggaggtggccaagtaa

DBGET integrated database retrieval system