KEGG   Halobacteroides halobius: Halha_0057Help
Entry
Halha_0057        CDS       T02401                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hhl  Halobacteroides halobius
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hhl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hhl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hhl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(53981..55450)
Genome map
AA seq 489 aa AA seqDB search
MFKQRKVLSSILVVAMVALLITSLTSTPTNAWWIFGEDSQEESQVKTKQTNKQPKYVFLF
IGDGMAASQRQLASYFLKAKTGNQDAQLTMNKLPVGGMNTTYASNTLVTDSAAAGTALAT
GYKTNKGMIGQLPNGTSVRTIIEAAEAKGMGTGVISTMRLTHATPASFLAHNESRYNPNQ
IAEDIAQSNVDFLAGGGYRHFIPKTAKKSERKDNKNLVKVFKDKDYKTFVGDPQGFRAYK
PKKGDKVFAPLTASHLPYELDRNPNTTPSLAEITQKGINTLVKHDNGFVMMVEGGRIDYA
GHANSPATVANDVLAFDKAVQKAYRFYKKHPKETLIVVTGDHETGGLGLGFKNNYFLNID
KLLPIKSSLDQLNYTGDRKAFFTSLKKDYGLTNLTAKEKAKIEKAMNLADAGKKLVNYMP
GWMSPVNAMVAKIVSARAGLFWTTYAHTGTAVPLTAAGVGANNFSGYKDNTQVAKEMANL
LDLKLTNLK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacaaagaaaagttttaagtagtatcttagtagtagcaatggtagctttattg
ataacaagtcttacttctactccgactaatgcatggtggatatttggggaggactctcaa
gaagaatcacaagtaaaaaccaagcaaactaataaacaacctaaatatgtattcttattt
attggtgatggtatggctgcttcccaaaggcaattagcaagttacttcttaaaagctaag
acaggtaatcaagacgcacagctaacaatgaataaattaccagtgggtggaatgaatact
acttatgcatctaatacattggtaacagattcagctgcagctggaactgctctagctact
ggctataagacaaataaagggatgattggacaattaccaaatggtacttctgttcgaaca
attatagaagcagcagaagctaaaggaatgggcactggagtaatctctactatgagatta
actcacgctactccggcctctttcttagcccataatgaaagtagatataacccaaatcaa
attgctgaagatattgctcaaagtaatgttgactttttagctggtggtggataccgacac
tttattcctaaaacggctaaaaaatctgaaagaaaagataataaaaacttagttaaggta
tttaaagataaagactataagacttttgttggtgatccacaaggttttagagcttataaa
cctaaaaaaggagataaagtctttgctcctttaactgctagtcacttaccatatgaacta
gacagaaatccaaatactactccaagcttagcagaaatcactcaaaaaggaattaacact
ttagttaaacatgataatggttttgttatgatggttgaaggaggaagaattgactacgct
ggtcatgctaacagtcctgctacagtagctaatgatgtattagcttttgataaagctgtt
caaaaagcttataggttttataaaaaacatcctaaagaaactttaattgtagttactggt
gatcatgaaactggtggtttaggattaggatttaaaaacaattatttcttgaatatagat
aaattacttccaattaaatcttccctagatcaacttaattatactggagatagaaaagca
ttcttcacttctcttaaaaaagattatggattgactaatttaactgcgaaggaaaaagct
aaaattgaaaaagcaatgaatttagcagatgcaggcaaaaaattagtaaattatatgcca
ggttggatgagtccagttaatgctatggtagctaaaattgtctctgcacgagctggatta
ttctggactacttatgcccatacaggaactgcagttccattaacagctgcaggagttggt
gctaataactttagtggatacaaagataatactcaagttgctaaagaaatggctaattta
ttagatctcaaattaacaaatttaaaataa

DBGET integrated database retrieval system