KEGG   Halobacteroides halobius: Halha_0092Help
Entry
Halha_0092        CDS       T02401                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hhl  Halobacteroides halobius
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hhl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
95054..95923
Genome map
AA seq 289 aa AA seqDB search
MDIQAYAKINLTLDVLDRRTDGYHIVKMIMQNISLYDNLSFSRGNSGIEITTNHPHLPTG
PSNLVYKAAELLFNEFNLDGGLEIFIDKQIPVAAGLAGGSTNAAATLVAINKLWGLGLTK
DQLATRGAQLGADIPFCIKGGTQLATGIGTQLKELPTCPKLYLVVVNPPLEVSTAQVYQN
LTLDEVTKHPETTKVIKALEEKNKKMVINNLSNLLELTTFDLYQEVATLKDNVESLTNKA
LMSGSGPTVLGFVKNKSQAKAVQAKLQEELSSKHRILVAQTVNHGLLDS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttggatatacaagcttatgctaagattaatttaactttagatgtgttagatagacgaact
gatggttatcatatagtaaagatgataatgcaaaatataagtttatatgataatttatca
ttttctaggggtaatagtggaatagagattacaactaatcatcctcatcttcctactggg
ccaagtaatttggtttataaagctgcagaattattatttaatgagtttaatttagatggt
ggattagaaatttttattgataaacaaattcctgtagcagctggtttagctggtggtagc
actaatgcagctgctacattagtagcaattaataaattatggggcttaggattaactaaa
gatcagttagctaccagaggtgctcaattaggggccgatataccattttgtatcaaaggg
gggactcaattagccactgggataggaacacaacttaaagaactacctacttgtcctaaa
ctatatttagtagtagttaatccccctctagaagtttctacagctcaagtttatcaaaat
ttgacactagatgaagttactaagcatcctgaaactactaaggtgattaaggcattagaa
gagaaaaataaaaagatggttataaataacctatctaatttattagaattaacaactttt
gatttataccaagaggttgctactcttaaagataatgtagaaagtttaacaaataaggct
cttatgtcaggaagtgggccaaccgtattaggttttgtaaagaataaaagccaagctaaa
gcagtacaagctaagttacaagaagagctatctagtaagcaccgaattttagtagctcag
acagtaaatcatggattactagactcctaa

DBGET integrated database retrieval system