KEGG   Halobacteroides halobius: Halha_0225Help
Entry
Halha_0225        CDS       T02401                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hhl  Halobacteroides halobius
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halha_0225
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halha_0225
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Halha_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218312..219199
Genome map
AA seq 295 aa AA seqDB search
MEVKVLGVPTDFGANRRGVDMGPSAIRYANLVSSLEDMDLVVDDLGDIRVPVINNEANKE
EAKFLSQVIDVCQELALIVSKIAKQDKLPVILGGDHSITIGSVAGMAQVKEMGLIWFDAH
GDFNTLKTSESGNIHGMPLATIVGRGVKELVECGGITPKVKEKNTVIVGVRDLDKEERQL
LKESEVTVFTMDDIDRLGIYKVMSQAIRIIGSQTAGVHISFDLDVLDPLEAPGVGTPVKG
GLTYREAHLALEMIAEANIVASLDLVEVNPILDQGNQTAELAVELIASALGKRIL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggaggttaaagtattaggagtaccaacagattttggagcaaatcgtagaggggttgat
atgggtcctagtgcaatcagatatgctaatttagttagtagtttagaagatatggattta
gtggttgatgatttaggtgatattagggttcctgttattaataatgaagctaataaggaa
gaagctaagtttttatctcaggtaattgatgtttgtcaagaattggccctaatagttagt
aaaattgctaaacaagataaactacctgttattttaggtggggatcatagcattactata
ggtagtgtagctggaatggcccaagttaaagaaatgggattaatttggtttgatgctcat
ggtgattttaataccctaaagactagtgaaagtggtaatatccatggtatgcctttagca
acaatcgtaggtagaggagttaaagaattagtagaatgcggtgggattacccctaaagtt
aaagagaaaaatacagtaatagtaggagttagagatttagataaagaagaacgacaatta
ttaaaggagtcagaggtaactgtatttaccatggatgatatagataggctaggtatttat
aaagtgatgagccaagcgattaggattattggctctcagactgctggagtacatattagt
tttgatcttgatgtattagatccattagaggctcctggagtaggaaccccagttaaagga
ggacttacctatcgtgaagcacatttggctttagagatgatagcagaagctaatatagtc
gcttctttggatttagtagaggtaaatcctattttagatcaaggtaatcaaacagcagag
ttagcagtagaattaattgcttctgctttaggcaagagaattttataa

DBGET integrated database retrieval system