KEGG   Halobacteroides halobius: Halha_0266Help
Entry
Halha_0266        CDS       T02401                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hhl  Halobacteroides halobius
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Halha_0266
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halha_0266
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Halha_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272421..273788
Genome map
AA seq 455 aa AA seqDB search
MTKKDIKIIQTAKDTEDRLSEKEDLQFTTEYNNNLPTLEINQEEEYQEITGFGGAFTEAG
GYTLSQIPEEKRQEVIEAYFHPEKGIGYTLCRTHINSCDFSLGNYAYTETEGDTELEDFD
ISRDKEYLIPFINDALNVEEAEFKLFASPWSPPAWMKTNERMNQGGSLKEEYWQTWANYF
AKYIKEYREEGIDMWGVTIQNEPMAETPWDNCIYQDEEERDFVKVLGPTLKEAGLEDIKI
MVWDHNKDIMKSRVDTILSDEEAAQWVWGVGFHWYGSSDSKSIEDDKVLSYTYQTYDKEL
VFTEGCNPLYDEDNFFGEWWTGEKYGRHIISNLNHYTTGWVDWNMVLNEEGGPNHVENYC
DAPIIVDTENNEIIYESPYYYLGHFSKYIRPGAKRIACNSDTNQLRVTAAKNPDGKIAVI
VMNESDEEISFNLKNNDGQATRVVSPAHSIQTLIY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaggacattaaaataattcaaactgctaaagatacagaagatagattatca
gaaaaagaagatttacaatttacaacagaatataataataatttaccaacacttgaaatt
aatcaagaagaagaatatcaagagattactggttttggtggtgcttttactgaagcagga
ggttataccttatcccagataccagaagaaaagagacaagaagtaattgaagcttatttc
catcctgaaaaaggaattggctatactttatgtcggactcatattaatagttgtgatttt
tcattaggaaattatgcttatactgaaactgaaggggatacagaattagaagattttgat
atctctcgagataaagaatatttaattccttttattaatgatgctttaaatgtagaggaa
gcggaatttaaattatttgcatcaccttggagtcctccagcttggatgaagactaatgaa
agaatgaatcaaggtggaagtttaaaagaggaatattggcagacttgggccaactatttt
gctaaatatattaaagaatatcgagaagaaggcatagatatgtggggagtaacaattcaa
aatgagccaatggctgaaactccttgggataattgtatttaccaagatgaagaagaacga
gactttgttaaagtactagggccaacgttaaaagaagccggacttgaagatatcaaaatc
atggtctgggatcataataaagatattatgaaatctcgtgtagatactattttatctgat
gaagaagctgctcagtgggtgtggggtgtaggctttcactggtatggtagtagtgatagt
aaatctattgaagatgataaagtattaagttatacttatcaaacttatgataaagaatta
gtctttacggaaggttgcaatccactctatgatgaagataacttctttggcgagtggtgg
acgggggaaaagtatggtcgacatattatttctaacttaaatcattatacaacaggttgg
gttgattggaatatggttttaaatgaagaaggcgggccaaaccatgtagaaaattattgt
gatgctccaattatagttgatactgaaaataatgaaattatttatgaaagtccttattat
tatttaggacatttcagtaagtatattcgtcctggagctaaacgaattgcttgtaattca
gacactaatcagttaagggttacagcagctaaaaatcctgatggaaaaattgcagttata
gtgatgaatgaaagtgatgaagaaatttcattcaatctaaaaaataatgatgggcaagct
actagagtagtcagtccagctcattcaattcagacattaatttattaa

DBGET integrated database retrieval system