KEGG   Halobacteroides halobius: Halha_0392Help
Entry
Halha_0392        CDS       T02401                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hhl  Halobacteroides halobius
Pathway
hhl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhl01100  Metabolic pathways
hhl01110  Biosynthesis of secondary metabolites
hhl01130  Biosynthesis of antibiotics
hhl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halha_0392
Enzymes [BR:hhl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Halha_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C EcoEI_R_C
Motif
Other DBs
NCBI-ProteinID: AGB40387
UniProt: L0K552
Position
401781..402551
Genome map
AA seq 256 aa AA seqDB search
MILDRIVKHKKEEVKEEKSKESLKELKLRINDLPGTRDFKAALKKPGVSLIAEVKKASPS
KGVIKAEFNPEEIVKEYQTAGARAVSVLTDQKFFQGQLDYLRLVKEKVKLPILRKDFIID
PYQIYQARAYRADAILLIAAILTTQQLRDYLILANKLDLDVLLEVHNREELYQALEVDAD
LIGINNRNLKVFEVDLATTLGLQRLVPNDKVIISESGIKTKSDINLLAKHNIDGVLVGES
LMKSDDISAKVKELIG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaccggatagtaaagcataagaaagaagaagttaaagaagaaaagagtaag
gaaagtttaaaagaattaaaattacgtattaatgacttgcctggtacaagagactttaaa
gctgctttaaaaaaaccaggggttagcttaattgctgaagtaaaaaaagcttctccttca
aaaggtgtaattaaagcagaatttaatccagaggaaatagtaaaagagtatcaaacagca
ggtgctagagcagtctctgttttaactgatcagaaattttttcaggggcaattagattat
ttacggttagttaaagaaaaagttaaacttcccattttaaggaaagactttatcattgat
ccctatcagatttatcaggctagagcttatagagcagatgctattttgttaatagcagct
attttaactactcagcaattaagagactatctaattttagctaataagttagatttagat
gtattactagaagttcataatagagaagaattatatcaagctttagaagttgatgctgat
ctaattggaattaacaatcgtaatttaaaggtgtttgaagttgatctagcaactacacta
ggattgcaaaggctagttccaaatgataaagtgattattagtgaaagtggaattaaaact
aaatctgatattaatttattagctaaacataatattgatggggttttggtaggagagtct
ttaatgaagagtgatgatattagtgctaaagtaaaggagcttattggctaa

DBGET integrated database retrieval system