KEGG   Halobacteroides halobius: Halha_0392Help
Entry
Halha_0392        CDS       T02401                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hhl  Halobacteroides halobius
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hhl01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hhl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
401781..402551
Genome map
AA seq 256 aa AA seqDB search
MILDRIVKHKKEEVKEEKSKESLKELKLRINDLPGTRDFKAALKKPGVSLIAEVKKASPS
KGVIKAEFNPEEIVKEYQTAGARAVSVLTDQKFFQGQLDYLRLVKEKVKLPILRKDFIID
PYQIYQARAYRADAILLIAAILTTQQLRDYLILANKLDLDVLLEVHNREELYQALEVDAD
LIGINNRNLKVFEVDLATTLGLQRLVPNDKVIISESGIKTKSDINLLAKHNIDGVLVGES
LMKSDDISAKVKELIG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaccggatagtaaagcataagaaagaagaagttaaagaagaaaagagtaag
gaaagtttaaaagaattaaaattacgtattaatgacttgcctggtacaagagactttaaa
gctgctttaaaaaaaccaggggttagcttaattgctgaagtaaaaaaagcttctccttca
aaaggtgtaattaaagcagaatttaatccagaggaaatagtaaaagagtatcaaacagca
ggtgctagagcagtctctgttttaactgatcagaaattttttcaggggcaattagattat
ttacggttagttaaagaaaaagttaaacttcccattttaaggaaagactttatcattgat
ccctatcagatttatcaggctagagcttatagagcagatgctattttgttaatagcagct
attttaactactcagcaattaagagactatctaattttagctaataagttagatttagat
gtattactagaagttcataatagagaagaattatatcaagctttagaagttgatgctgat
ctaattggaattaacaatcgtaatttaaaggtgtttgaagttgatctagcaactacacta
ggattgcaaaggctagttccaaatgataaagtgattattagtgaaagtggaattaaaact
aaatctgatattaatttattagctaaacataatattgatggggttttggtaggagagtct
ttaatgaagagtgatgatattagtgctaaagtaaaggagcttattggctaa

DBGET integrated database retrieval system