KEGG   Halobacteroides halobius: Halha_0692Help
Entry
Halha_0692        CDS       T02401                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hhl  Halobacteroides halobius
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Halha_0692
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Halha_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665061..666218
Genome map
AA seq 385 aa AA seqDB search
MKQISILGSTGSIGTQTLEVIENLDEEISVVAITANNSIDLLVQQAKKFKVDYAVIMNEE
KVSQLESKLTGTTITVLSGLEGLTKVATLEQVDLVINSVVGAIGVRPTLAAIKAGKDIGL
ANKETLVTAGSIVTREAKKNGVKLLPIDSEHNAIFQVLNGEKSTSIKRLILTASGGPFRE
ATASELKEVTVEDALDHPNWDMGGKITIDSATLMNKGLEVIEAHWLFDLSFDKIDVVVHP
QSIVHSLVEFKDHSTIAELGLPDMKVPIQYVLTYPNRKENNLESLNLAEVRKLTFEEAKT
DLFSCLEYAYQAGKVGGTMPAVLNAANEIAVSKFLSHQLKFNQIPELISKVISNHQVVYK
PTLDQILQADTWARSEAQKVGDQIC
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatatctattttaggttctacaggctcaattggaacgcaaactttagaggta
atagagaacttagatgaagaaatttctgtagtagctataactgctaataacagtatagat
ttattagttcagcaggctaaaaaatttaaagttgattatgcagtgattatgaacgaagaa
aaagttagtcaattagaaagtaagttaactggtactacaattactgttttatctggttta
gaaggtttaactaaagtagctactttagagcaagttgatttagtaattaattcagtagta
ggtgcaataggtgttagacctactttagcagcaattaaagcaggaaaagatataggttta
gctaataaggaaacattagtaacagcaggttctattgtaactagagaagctaagaaaaat
ggagtaaagttgttaccaattgatagtgaacataatgctatttttcaggtcttaaatggt
gaaaaatcaactagtataaaaaggttaattttaactgcttctggaggtccatttagagaa
gctactgcatcagaattaaaagaagttacagtagaggatgctttagatcatccgaattgg
gatatgggtggtaaaattactattgattcagcaactttaatgaacaaaggattagaagtc
atagaagcccattggttatttgatcttagttttgataaaatagatgttgtagttcatcca
caaagtattgttcattctttagtagagtttaaagatcattctacgatagctgaattggga
ttacctgatatgaaagtaccaattcaatatgtattaacctatcctaataggaaagaaaat
aatttagagagtttaaatttagctgaagtcagaaaattaacttttgaagaagcaaagact
gatttattttcttgtttagaatatgcttatcaagcaggtaaggttggaggaacaatgcct
gctgttttaaatgctgctaatgaaatagcagtgagtaaatttctaagtcatcaacttaag
tttaatcaaataccagagttaatttctaaagtaatctccaatcatcaagtagtttataag
cctacgttagatcaaattctacaagcagatacttgggctaggagtgaagcccagaaagtg
ggggatcagatttgttaa

DBGET integrated database retrieval system