KEGG   Halobacteroides halobius: Halha_0763Help
Entry
Halha_0763        CDS       T02401                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hhl  Halobacteroides halobius
Brite
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Halha_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738068..738796
Genome map
AA seq 242 aa AA seqDB search
MKYLDQLAKPFFWEAGNKACLIIHGFTGTPAHMRQLGEFLYQKGDYTVSGILLPGHGTSM
EDMEESTWRDWLQAAREEYERLDQAYDQVYVMGLSMGGALTLLLAEEYNVDKIIPIAAPI
KIFDKKAYLAPILKYFKRFEHWEESEEKDKYDIGYLGMPVKSIQDLLKLMRLAKQDLGQI
DSPALIVQSYQDETVKPISAKLIYDGIMSLDKEIMWLERSGHVCTLGPEKDQIHKKILNF
LG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctggatcaattggctaagccttttttctgggaagcaggtaataaagcttgt
ctgattattcatggatttacggggactccagctcatatgagacaactaggtgagttctta
tatcaaaagggagactacactgtaagtggcattttattaccaggacatggtacttctatg
gaggatatggaagagagtacttggcgtgattggttacaggctgctagagaagaatacgaa
agattagatcaggcatatgatcaggtttatgtgatgggtttatcaatggggggagcatta
actttattattggcagaggaatataatgtagataagattattcctattgcagctccaatt
aaaatttttgataaaaaggcttatcttgcaccaatcttaaagtactttaaacgttttgaa
cactgggaagagtcagaagagaaggataaatatgatattggttatttaggaatgcctgtt
aagtctattcaagatttattgaagttgatgagattagctaaacaagatttgggccaaata
gattctcctgctttaatagttcagtcctatcaggatgaaacagttaagcctattagcgct
aagctaatttatgatgggattatgagtttagataaagagataatgtggttagagaggtca
ggccatgtttgtactcttggcccggaaaaggatcagattcataagaaaatacttaatttt
ttgggttga

DBGET integrated database retrieval system