KEGG   Halobacteroides halobius: Halha_0913Help
Entry
Halha_0913        CDS       T02401                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hhl  Halobacteroides halobius
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halha_0913
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halha_0913
Enzymes [BR:hhl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Halha_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893278..894210
Genome map
AA seq 310 aa AA seqDB search
MGLIKKDLLGLQDLTKEEIELILETAQSMTEVLNRSIKKVPTLRGKLVVNLFYEPSTRTK
SSFGLAAKRLSADGMNLSIKQSSVVKGESLVDTAKTLRALGADGVVIRHGVPGAAKLLAE
TVEIPVLNAGDGMHEHPTQALLDLYTIQKKREEIADKKVAIIGDIKHSRVARSNIWGLNK
LGAEVRLVGPTTLMPANIEQMGAKVYTSLEEGIKDVDVIYLLRIQQERQDKGFFPTIKEY
TRFYGLRKEALKLATKDALIMHPGPINRGIEISRELAYSNQSVIEDQVSNGVAIRMALLY
LLIEGGLEDE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggctaataaaaaaagatttattaggattgcaagatctaactaaagaagaaattgag
ttgattttagagacagcccagtcaatgacagaagtattaaatagatcaataaaaaaagta
ccaacattaaggggtaagctagtagttaatcttttttatgaaccaagtactagaacgaaa
tcatcttttggattagcagctaaaagattaagtgcagatggtatgaacttatctatcaaa
caaagtagtgtagtaaaaggagagagcttagtagatactgctaagactttaagagcttta
ggagccgatggagtggtgattagacatggtgtacctggggctgctaaattactggcggag
acagttgaaatcccagtcttaaatgctggagatgggatgcatgaacatccaacacaggct
ttattggatttatacactatacaaaagaaaagagaagaaatagcagataaaaaagtagca
attattggtgatattaaacatagtcgggtagctcgctcaaacatttggggcttaaataag
ttaggggcagaggtaaggttagtagggccaactactttaatgccggctaatatagaacaa
atgggagctaaagtttatactagtttagaggaaggaattaaggatgtagatgtgatttat
ctattgagaattcagcaggaacgtcaagataaaggcttctttcctacaattaaagaatat
actcgattttatggtttaagaaaagaagctttgaagttagctacaaaagatgctttgatt
atgcatccggggccaattaatagggggattgagatttctagagaattagcttacagtaat
caatcagtaattgaagatcaagtatctaatggagtagctattcgaatggcattattatac
ttattaatagaaggagggttagaagatgagtaa

DBGET integrated database retrieval system