KEGG   Halobacteroides halobius: Halha_0937Help
Entry
Halha_0937        CDS       T02401                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hhl  Halobacteroides halobius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halha_0937
Enzymes [BR:hhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Halha_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921170..922669
Genome map
AA seq 499 aa AA seqDB search
MKFERKSGIFLHPTSLPGEYGIGSLGAEAYQFIDFLSLADQGLWQVCPLGPTGYGDSPYQ
PFSAFAGNPYLISLDKLVAEGLLAKSDLDNSIDFDQTRVEYGKVIDYKMPLLKKAFKVFK
NSKIEEKAFNKFCRKNKKWLADYALFRALKDYFGGQAWVDWDYDIKFREEEAIVSYQKQL
KDQIEFRYFLQFIFFKQWAALKKYANNKGIKIIGDIPAFIALDSADAWANSQFFCLDENR
LPTKVAGTPPDYFSPKGQLWGNPLYDWKHLRRDNYQWWIDRFNLMLELTDIIRIDHFRAF
ISYWAVPYGKETAVNGNWELGPQEHFFKIVKKKLGKLPFIIEDLGLINERVKEVRNKFDF
PGMKVLQFAFHEDLENKYLPHNYSKNSIVYTGTHDNNTTKGWYHNQAKSKEKNLLEEYTT
KYLTESTYNKPSWNLLELAWSSKAVLAIAPLQDIISLGSQARLNNPGVASGNWQWKYQEK
MLTLDLAEQLKDLTYQYNR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaagaaagagtggtatcttcttgcatccaacttctttaccaggtgagtat
ggaattggaagtttaggagcagaagcttatcaatttatagattttttaagtctagcagat
caaggtttgtggcaagtgtgtcctttagggccaactggctatggtgattcaccgtatcag
cctttttcggcttttgctggcaatccttatttaattagtttagataagttagttgctgaa
ggtttattagctaaaagtgacttagataactcaattgattttgaccagactagagtagaa
tatggtaaagttattgattataagatgccattattaaaaaaagcttttaaagtatttaaa
aattctaagatagaagaaaaggcatttaataaattttgtcgaaaaaataagaagtggctt
gctgattatgctttatttagagctttaaaggattattttggtggacaagcttgggtggat
tgggattatgatattaaatttagagaagaagaagctatagttagctatcagaagcaatta
aaagatcaaattgagtttcgctacttcttacagtttattttctttaaacaatgggctgct
ttaaagaagtatgctaataataaaggaattaagattattggagatattcctgcttttatt
gctcttgatagtgctgatgcttgggccaactctcaatttttttgtcttgatgagaatcgg
ctaccaaccaaagtagcaggaaccccacctgattattttagccctaaaggccaactatgg
ggtaatcctttatatgattggaagcatctgagaagagataattatcagtggtggatagat
aggtttaatttaatgttagaattaacggatattatacgtattgatcactttagggctttt
atatcttattgggcagttccttatgggaaagaaactgctgtaaatggtaactgggagctt
ggccctcaggaacacttctttaaaatagtaaagaaaaaattaggtaaattgccatttatc
attgaagatttaggtttgataaatgaaagagtaaaagaagtaagaaataagtttgacttt
cccgggatgaaggtattacaatttgcttttcatgaagatctggaaaataaatatttgcca
cataattattctaaaaattctattgtttatacaggaacccatgataataatactactaag
ggatggtatcataatcaagctaaatctaaagaaaagaatttattagaagaatatacgact
aaatatctaactgaaagcacatataataaaccctcttggaatttgctagagttagcttgg
tcttctaaagcagtattagctattgctcctttacaggatatcatttctttaggcagtcaa
gctagattaaataatcctggagttgctagtggtaactggcagtggaagtatcaagaaaaa
atgttgaccttggatttagcagagcaattaaaggatttaacctatcagtataatagatag

DBGET integrated database retrieval system