KEGG   Halobacteroides halobius: Halha_0990Help
Entry
Halha_0990        CDS       T02401                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hhl  Halobacteroides halobius
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halha_0990
  Amino acid metabolism
   00340 Histidine metabolism
    Halha_0990
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Halha_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975463..976752
Genome map
AA seq 429 aa AA seqDB search
MLDILDTGQAGAKEKLATILNRSSFDSQEQIDVVQDIWDNIQNRGIEAVLEYTARFDGAK
LEQLEVSQTEIKAAYKQVDQDFLAAIQKSIENVRKFHQQQLREDWMDIKDDGVILGQKFE
PLARVGIYVPGGRAAYPSSVVMNGVPAKVAGVDEIVMVSPPAKDGSLNPHTLVAAAEVGV
DTIYKIGGAQAIAALSLDLAEIKKVDKIVGPGNIYVTLAKKLAYGYVDIDMLAGPSEILV
LADQDANPKYIAADLLSQAEHDPMASAVLVTTSKDLAKEVKLELEEQLTNLSRAKIAKEA
LKNYGALLVAKDMEEAISLTNQFAPEHLEVKVESPFSILGKLKNAGAIFLGEYAAEPIGD
YVAGPNHVLPTGGSAKFYSPLNLDDFVKKSSIIHYSKEGLDKVKDQALKIAEVEGLDAHA
NSIRVRIED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttagatatattagatacgggccaagcgggagctaaagaaaaattggctactatttta
aatcgttcttcatttgatagtcaagaacagatagatgttgtccaagatatttgggataat
atacaaaatagaggaattgaagctgttttagagtatacggctcgttttgatggagccaag
ctagagcaattagaagtaagtcaaacagagattaaagctgcctataaacaagttgatcaa
gactttctagccgcaattcaaaagtcaattgaaaatgtaagaaagtttcatcaacaacag
ttacgcgaggattggatggatattaaggatgatggagtaattttaggacaaaagtttgaa
ccattagctagagtaggtatctatgttccaggtggtagagcagcttatccttcttcagta
gtgatgaatggagtaccagctaaggtagcaggagtagatgagatagtgatggtctctcct
ccagctaaagatgggagtttaaatcctcatactctagttgcagcagctgaagtaggagta
gatactatttacaaaataggtggggcccaagctatagcagctttgagtttagacttagca
gagattaaaaaggtagataagattgttggcccgggtaatatttatgtgacgttagctaaa
aagttagcctatggttacgtagatattgatatgttagcagggccaagcgaaattttagtc
ttagcagaccaagatgctaatcctaaatatatagcagctgatttattatctcaagcagaa
catgatcctatggcttctgcagtcttagtaactacttctaaagatttagctaaagaagtt
aagctagagttagaagaacaattaacaaatctatctagagccaagatagcaaaagaggcc
ttaaagaactatggagctttattggtagccaaggatatggaagaagctatttcactaacc
aatcagtttgctccagaacatttagaagttaaagtagaatcacctttctctattttaggt
aagttaaagaatgctggagctatctttttaggggagtatgcagctgaaccaataggcgat
tatgtagccggtcctaatcacgttttaccaactggaggatcagctaaattttattctcca
ttaaatcttgatgattttgttaaaaaatctagcattattcattactccaaagaaggatta
gataaggttaaagatcaagccttaaagatagctgaagtagaaggattagatgcacatgcc
aatagtattcgggtgcgaatagaggactaa

DBGET integrated database retrieval system