KEGG   Halobacteroides halobius: Halha_1001Help
Entry
Halha_1001        CDS       T02401                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hhl  Halobacteroides halobius
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halha_1001
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Halha_1001
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Halha_1001
Two-component system [BR:hhl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Halha_1001
Bacterial motility proteins [BR:hhl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Halha_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985205..986281
Genome map
AA seq 358 aa AA seqDB search
MASKIKVLVVDDSAFMRKVVSELLEEDREIEVIDKARNGRDALRKIEKHTPDVITLDVEM
PKMNGLDFLKRLKGKKAIPVIMLSSITTEDSKATIKALELGAFDFISKPSGSISLDIEKV
QDDLIEKVKLAAQTKVKRKLRRQFRSERKKKPKLNQQISASQESTVKNISNNQEKLVIIG
ASTGGPRAVKEVVSKLPADLNAAVLIVQHMPAGFTASLAQRLNKTSQLKVKEAQEGDRLE
AGVALVAPGDYHMLIKNNKVQLTKGPKVHNVRPAIDKTIGSVVKEYQNQIVGVLLTGMGK
DGAKGLKLIKEFGGQTIAQDEATSVVYGMPRVAFELGAVDSVKRIYKISNELVSMVNK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaaaataaaagttttagtagtagatgattcagcatttatgagaaaagtagtt
agcgaactattagaagaagatagagaaatagaagtgattgataaagcaagaaatggtaga
gatgccttacgaaaaattgaaaagcatactccagatgtaattactttggatgtggaaatg
cctaaaatgaatgggttagattttttaaaaaggttaaagggtaaaaaggctattccagtg
ataatgttaagtagtattacaactgaggacagtaaggcaactattaaggctttagaatta
ggagcttttgattttatctccaagccttcaggttccatttctttagatatagaaaaagtt
caagatgatttgattgagaaggttaaattagctgctcaaacaaaggtaaaaagaaagtta
agacgtcaatttagaagtgaaagaaagaagaaaccaaagttaaatcagcaaattagtgct
tctcaagagtcaactgttaaaaatatttctaataatcaagaaaagctagtcataattggt
gcttctactggtgggccaagagcagttaaagaagtggttagcaagttgcctgctgattta
aatgctgctgttttaattgtacagcatatgccagctggatttacggcgtccttggcccaa
agattaaataaaacatctcaattaaaagttaaagaggcccaagaaggtgatcgattagaa
gctggagtagctttagttgctcctggtgattatcatatgttaataaagaataataaagtt
cagttaactaaagggcctaaagttcataatgtacgccccgctattgataagacaataggt
tcagtagttaaagaatatcaaaatcaaattgttggtgtattactaactggaatgggtaag
gatggagctaaaggattaaaactaattaaagagtttggggggcagacaattgctcaagat
gaagctacttcagtagtttatggaatgcctagggttgcttttgaattaggagcagttgat
agtgtaaagagaatttataagataagtaatgaattagtgtcaatggttaataagtga

DBGET integrated database retrieval system