KEGG   Halobacteroides halobius: Halha_1027Help
Entry
Halha_1027        CDS       T02401                                 

Definition
alcohol dehydrogenase, class IV
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
hhl  Halobacteroides halobius
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Halha_1027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_1027
   00620 Pyruvate metabolism
    Halha_1027
   00650 Butanoate metabolism
    Halha_1027
  Lipid metabolism
   00071 Fatty acid degradation
    Halha_1027
  Amino acid metabolism
   00350 Tyrosine metabolism
    Halha_1027
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halha_1027
   00626 Naphthalene degradation
    Halha_1027
Enzymes [BR:hhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Halha_1027
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Halha_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010401..1012986
Genome map
AA seq 861 aa AA seqDB search
MQVTNKEELNKLIQNVKRAQERYSDYSQQEVDEIFKQAAIAANDKRIELAKLAVEDTQMG
VVEDKVIKNHFSAEYIYNRYKDNQTCGVIEEDDSYGIKKIAEPIGVIAGIVPVTNPTSTT
IFKSLLSLKTRNAIIFSPHPSARECTIEAAKTVLEAAVEAGAPRDIIGWIDEPSIELSQM
VMKHDDVNMILATGGPGMVKAAYSSGKPAIGVGAGNTPAIIDETAHLKMAVSSILMSKTF
DHGVICASEQSVTVVDEVYDEVKQEFDERGAYILSPKEKEKVANTLVEDGKINAKIVGQP
AHYIASLAGLEVPRETKVLIAEVEDVGTEEPFSYEKLSPTLAMYRAEDFKDAVDNATALV
KFGGIGHTSVLYTDQINEQRRDYFASKMKTGRILINMPSSQGAIGDIYNFKLQPSLTLGC
GSWGGNSVSENVGVRHLLNIKTTAQRQENMLWFKVPEDIYFKYGSLPTALTELKGKERAF
VVTDQELYDLGYAEEVTDELDKNNIDFRVFSDIEPDPTIDIVEKAVEQMKSYEPDLIIAL
GGGSPMDAAKIMWLIYEHPEVEFKELAMTFMDIRKRIYEFPELGNKAELVAIPTTSGTGS
EVTPFAVVTDDQSGIKYPIADYELTPSMAIVDPDLVLSMPPKLTAYSGIDALVHAIEAYT
SVLSNEYTKGLALEASRLVFKYLPRSYHNGGDDRKARAKMHYAATTSGMAFANAFLGVCH
SMAHKLGSAFHLPHGLANALLIEQVIKYNASDVPLKQTSYPQYKYPLGKRRYAKLANHLG
LGGNSDAEKVDLLIEAISELKQELDIPSSIADLGITEQEFYSKLDEMSELAFDDQCTAAN
PRYPLISEIKGLYLKAYKGEV
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagttactaataaagaagagttaaataaactaattcaaaatgttaagcgagctcaa
gaaagatatagtgattactcacaacaagaagttgatgagatatttaaacaagctgctata
gctgctaatgataaacgcattgagttagctaaattagctgtagaggatacccagatggga
gttgtagaagataaagtaattaagaatcatttttcagctgagtatatttataataggtat
aaagataatcaaacctgtggtgtcattgaagaggatgattcctatggcataaaaaagata
gcggaaccaattggagtcattgctggaatagtaccagtcaccaatcctacttcaacaact
atctttaagtcattattatctcttaagaccagaaatgctattatattctcaccgcaccca
agtgctagagagtgtactattgaggctgctaaaactgttttagaagctgcagttgaagct
ggagcaccaagagatattattggttggattgatgagccttcgattgaattatctcaaatg
gtaatgaagcatgatgatgtaaatatgattttagctactggagggccaggtatggttaaa
gctgcttattcttctggaaaaccagctattggagtaggagctggaaatactcctgctatc
attgatgaaactgcacatcttaagatggcagttagttccattttaatgagtaaaacattt
gaccacggagttatttgtgcctcagaacaatcagtaacagtagtagatgaagtctatgat
gaggtaaaacaagagtttgatgagcggggagcttatatattatctcctaaggagaaagaa
aaagtagctaatactttagtagaagatggtaagataaacgcaaagattgtgggccaacct
gctcattatattgctagtctagctggtctggaagttcctcgagagactaaagtattaata
gcagaagtagaagatgtcgggactgaggaaccattttcttatgaaaaattatcccctact
ttagctatgtatagagctgaagattttaaggatgcagtagataatgcaactgctttagtt
aagtttggaggaattggtcatacttcagttttatatacagatcagattaatgagcagcgc
agggattacttcgcttccaaaatgaaaacaggaagaatcttaattaatatgccatcttct
caaggagctattggggatatttataactttaagttacaaccatcgttgaccttaggttgt
ggtagttggggtggtaactcagttagtgagaatgtaggagtgagacacttattaaatatt
aagactactgcacaaagacaagagaatatgttatggtttaaggtaccagaagatatttat
tttaaatatggttctttacctactgctttgactgaacttaagggtaaggagcgagccttt
gtagtgacagatcaagaattatatgatcttggttatgctgaagaagttacagatgaatta
gataagaataatatagactttagggtcttttctgatattgaacctgatcctacaattgat
attgttgaaaaggcagtagagcagatgaaaagctatgaacctgatttaattattgctctt
ggtggaggttcgccaatggatgctgctaagatcatgtggttaatctatgaacatcctgag
gttgaatttaaggaattagcaatgacttttatggatattagaaagagaatttatgaattt
cccgagttgggaaataaagctgagctagttgcaattcctactacttctggaactggatcg
gaagtaactccctttgcagtagtaactgatgatcaatcagggattaaatatcctattgca
gattatgaattaactcctagtatggccatagttgatcctgatttagtattaagtatgcca
cctaaactaactgcttactcaggaattgatgctttagtacatgctattgaagcttataca
tctgtattatctaatgagtacactaagggcttggccctagaagcaagtagattagtcttt
aagtatctcccacgctcttatcataatggtggagatgatagaaaagctcgggccaagatg
cactatgctgcgactacctcagggatggcctttgctaatgcttttttaggggtttgccat
tcaatggcccataaacttggttctgcttttcatctacctcatggattagctaatgcttta
ttaattgaacaggtaataaaatataatgctagtgatgtaccacttaaacaaacctcttat
cctcaatataagtatcctttaggaaaaagaagatatgctaaattagctaatcatttaggt
ctaggaggtaatagtgatgctgaaaaggttgatttattaattgaagcaatttctgaattg
aaacaagaattagatattccaagtagtatagctgatcttggaattacagagcaggagttt
tatagtaaactcgatgaaatgtctgaattagcttttgatgatcagtgtacagctgctaat
cctagatacccattaattagtgaaataaagggattatatctaaaagcatataaaggagag
gtttaa

DBGET integrated database retrieval system