KEGG   Halobacteroides halobius: Halha_1119Help
Entry
Halha_1119        CDS       T02401                                 

Definition
ATP-dependent exoDNAse (exonuclease V), alpha subunit/helicase superfamily I member
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hhl  Halobacteroides halobius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Halha_1119
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Halha_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117269..1119806
Genome map
AA seq 845 aa AA seqDB search
MIKGRINKIYYDKDNFYIFSIIRDNHEQLTLKGNLPTEITKKIRPGNLVSTTGQKVWNDK
YKNHQITVNKHNIEIEEKGASEEDLEVLEGEVTSIVYKDDGFNVFRIDTAEDFTCVSSSP
VFIGTQLELKGYFEKNDYGLNFNVVQSKELPFSDKQALIHFLSSKFFKGIGKHFATKIVD
RFGLDTLDVFRETPEKLTTISGIGDKRAATIIESFQEKMKIKEVIKFAVKYEITENMIFK
LYEKYGKELINLLQQNPYLITELRGIGFKKADQIAQEIGLEKDSNYRINSFLTYYLSAKS
GGHTYFRLEELIETIEEELEIEQAFNQVLKAYYQFEEISYTIKENGELVTKKFTKDFVLF
TEDDLDPLTEDSKQDLSLLAKQEKLCVATEKSYQQEVDIYDKLKRINSRSATVNLATAEI
KELIKEQEQEQGFTYAKQQREILEQCLKEKLVVLTGKAGTGKSTVSKGIINMFTENGDKV
LNLAPTGKAAKRIIEVTDKRAHTIHSACYNLEFSNYDVIMVDEAGMLSTSVAHMLLKRLN
QDHTLVLIGDVAQIPPVQPGNIFRDVINMINSDFIAGLFVELDEIKRQDSNSHIATVCNK
IAEGTNPGIIDYQDIRSVKKDNEQILDYITRLIKDELEGDEVDFSNLQIISPQYNGIVGI
NAINELIQEEFNPHDYLIETKYKKVKRHDKVMQTMNMKELDIVNGDTLEVLRIENRAKED
TEISREGAADKEEIVICKLDNGLEERMIEYPKQDFIKYTTLAYCCSAHKMQGSEYPIVVY
ILSTSHYIMLNRNLLYTGLTRGKEKVYLVGQARAFYMALNNEVNQSRNTVLDLIKTHKLA
QINQE
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgattaagggacggattaataaaatatactatgataaagataatttttatatcttctcg
attataagagataatcacgaacaattaacccttaaggggaatttaccaactgagattact
aaaaaaataagaccaggaaatctagttagtacaacaggtcaaaaagtatggaatgataaa
tataaaaatcatcagattacggtcaataagcataatatcgagattgaagagaagggagct
agtgaagaagatttagaggttttagaaggagaagtaactagtatagtttataaggatgat
gggtttaatgtttttagaatagataccgcagaagattttacctgtgtctcaagttcaccc
gtctttattgggactcaacttgaattaaagggctattttgagaagaatgattacgggtta
aattttaatgtagtacaaagtaaagagttacctttctctgataaacaggcattaattcat
ttcttaagttctaaattttttaaaggaattggtaaacattttgcgactaaaattgtagat
agatttggcttagatacgttagatgtttttagagaaactccagagaagctaactactatc
tcaggcattggtgataaaagggcggctactattattgaatcttttcaagaaaaaatgaag
attaaagaagtaattaagtttgcagttaagtatgagattactgaaaatatgatttttaag
ttatatgaaaagtatggtaaagaattaattaatctcctacaacaaaatccctacttgatt
actgaattaagagggattggttttaaaaaggctgatcaaatagctcaagagattggctta
gaaaaagacagtaattatcgtattaatagctttttaacttattatttatcagctaaatca
gggggacatacttactttagattagaggagttaatagagactattgaagaggaattagag
atagaacaagcctttaatcaggtcctaaaagcttactatcagtttgaagaaataagttat
actattaaagaaaatggtgaattagtaactaaaaaatttactaaggactttgtattattt
actgaagatgatttggatccattaactgaggatagtaagcaagatctcagtttgttagct
aaacaggaaaaattatgtgtagcgactgaaaaaagctatcaacaagaggttgatatttat
gataagttaaagaggattaactctaggtctgctactgttaatttagctacagcagaaatt
aaagagttaatcaaagagcaagaacaagagcaaggttttacatatgctaagcaacaacga
gagatactagagcaatgcctaaaagagaagttagtagtcttgactggtaaagcaggaacc
ggtaaatcaactgtatctaaagggattattaatatgtttactgagaatggagataaggtc
ttgaacttggccccaacaggtaaagcagccaaaagaataattgaagtaacagataaacgg
gctcatacaatccatagtgcttgttataaccttgaatttagtaattatgatgtaattatg
gttgatgaagcaggaatgttatcgacttctgtagcgcatatgttactgaagagattaaat
caagatcatactttagtcttgattggggatgttgctcaaattcctcctgttcaacctggt
aatatttttagggatgttattaatatgattaatagtgactttatagccggattatttgta
gagcttgatgagattaaaaggcaagatagtaatagtcatatagcaacggtttgcaataaa
atagcggaaggaactaacccggggataattgactatcaggatattagatcagttaaaaag
gataatgagcagatattggattatattacaaggctaattaaagatgaattagaaggtgat
gaggtagactttagtaatttgcagattattagtccgcagtataatgggatagtaggtatt
aatgctataaatgaattaatccaagaagaatttaatcctcatgattatttaattgagact
aaatacaaaaaggttaaacgtcatgataaagtgatgcagacaatgaatatgaaagaatta
gatattgtaaatggtgatactttagaagttttaagaattgaaaacagggccaaggaagat
actgaaatatctagagaaggagcagcagataaagaagaaatagtaatttgtaaattagat
aatggtttagaagagagaatgatagaatatcctaagcaggattttattaaatacactact
ttagcttattgttgttcagctcataagatgcagggctctgaatatccaatagtagtctat
attttatctacttctcattatatcatgcttaatagaaatcttttgtataccgggttaact
agaggaaaagaaaaggtttatcttgttggccaggctagagctttttatatggctttaaat
aatgaagttaatcagagtaggaatactgttttagatttaattaagactcataaactagcc
caaataaatcaagagtaa

DBGET integrated database retrieval system