KEGG   Halobacteroides halobius: Halha_1257Help
Entry
Halha_1257        CDS       T02401                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
hhl  Halobacteroides halobius
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hhl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269361..1270875
Genome map
AA seq 504 aa AA seqDB search
MLGKVYIIGAGPGDEGLITAKGLKIIKQADVILYDRLANPKLLNQAQEEAQLFYVGKKAG
EHYRTQTEINQLLIEQAQAGKLVARLKGGDPFIFGRGGEEATTLVEAGIEFEIIPGITSP
IAVPAYAGIPLTHRDFNSSVAFVTGHESPTKDQSQVNWSQLATGVGSLVILMGVRKLPQI
VPQLIDAGRDRQTPVALVRWGTRAKQETLVGTLENIVSKVEEANFKPPAIIIVGEVVKLR
KKLNWFEKKELFGKSIVVTRPQKQAQDFCQSLATAGAKVIEAPAIEIKPPVDYQELDNKL
EQLKSYDWVIFTSVNGVKYVIERLFSLGEDVRALAGVKLCAIGSKTAAKLKSYGLRVDYI
PEDYVSESILAGFSEQDLTSKKFLLPRANLARAALKEGLLDLGAEVDNITAYQTVEGSGN
NQVIKRLKEGEIDLITFTSSSTVRNFMNGLGSNYKKLLRGVDIACIGPITAGTARKYGLT
VEIIANEYTIAGLTEAIKKYYRRD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtaaggtctatatcattggagcaggtccaggtgatgaaggtttaattactgct
aagggactaaagataattaaacaagcagatgtaatcttatatgatcgattagcaaatcct
aaattattaaatcaggcccaagaagaagctcaattattttatgtaggtaaaaaagccggg
gagcattatcgaactcaaacagagattaatcaactattaattgagcaggctcaagcagga
aaattagtcgctcgtttaaaaggtggagatccttttatttttggtcggggcggagaagaa
gctacaactttagttgaagcaggaatagaatttgaaattattcctgggattacttctcct
attgcagtacctgcttatgcagggattcctttaactcaccgagactttaattcatctgtc
gcttttgtcacaggacacgaaagtccaactaaagatcaatctcaggttaattggagccag
ttagcaacaggagtaggtagtttagtaatcttaatgggggtaaggaagctacctcagatt
gtaccccaattaatagatgcaggtcgagatcgacagacaccagttgcactagttagatgg
ggcactagagctaagcaagagactttagttggtactttagagaatattgttagtaaagta
gaggaagctaactttaagccaccagcaattataatagttggtgaagtagttaaactaaga
aaaaagttaaactggtttgaaaagaaagaattatttgggaagagtattgtagtaactcgg
cctcaaaagcaggcccaagatttttgccaatcattagctacagcaggggccaaggtaatt
gaagctcctgctatcgaaattaaaccgccagttgattatcaagaattagataataagtta
gagcaattaaaaagttatgattgggttatctttaccagtgttaatggggttaaatatgta
atagaaagattatttagtttaggagaggatgtacgggctttagctggagtaaagttatgt
gctattggctctaagacagctgccaagctaaaatcctatggcttaagagttgattatatt
cctgaagattatgtaagtgaatcaattttagcaggatttagtgagcaagatttaacaagt
aagaaatttttattacctcgggccaaccttgctagagcagctctaaaagaaggattgctc
gatttaggggcagaagttgataatataacggcttaccaaacagtagaaggtagtggaaat
aaccaggtaattaagaggttaaaggaaggggagattgacttaataacttttactagctca
tctacagtccgtaattttatgaacgggttaggaagtaattataaaaaattgctacggggt
gttgatatagcttgtattggcccaattacagctggtacggctagaaagtatgggttaaca
gtagagataatagctaatgagtataccattgcaggtttaactgaggcaatcaagaaatat
tataggagggattaa

DBGET integrated database retrieval system