KEGG   Halobacteroides halobius: Halha_1290Help
Entry
Halha_1290        CDS       T02401                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hhl  Halobacteroides halobius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halha_1290
Enzymes [BR:hhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Halha_1290
Exosome [BR:hhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halha_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291394..1293613
Genome map
AA seq 739 aa AA seqDB search
MISDQNKINKLITGNCKDPFEILGIHRLNKEQVIIRIFRPKVKKAFIISDILENDIKLNK
INKEGFFEKVINKSKLFNYKLKLENEQGEKWITKDPYSFLPIISEYDLHLFNEGNHHQIY
EKMGAHITTKKGVSGTHFSVWAPEAKRVSVVGDFNNWDGRVHQMRMLGASGVWEIFIPNI
TEGELYQFEIKTKSDRVLMKSDPYAFYSELRPAKASIIYEINNKHEWKDDKWMKERKEKE
WLKEPISIYEVNLSSWAKVPEEKNRFLTYRELADQLVNYIKQNNYTHVELMPLAEHPLDE
SWGYQITGYFSATSRFGKPEDLMYLIDQFHQHNIGVILDWVPGHFPKDAHGLGRFDGSAL
YEHLDPLLGEHLKWGTYIFNHGRNEVKNFLISNALFWLDKFHIDGLRVDAVSSMIYLDHG
RQHWRTNAYGGTENLAAIEFLKYFNSITHKYYPGILTIAEEATSRPGITSPTYSDGLGFS
MKWNMGWMHDSLEYIEAESTHRKYHHNNLTFSLTYAFNENYLLSLSHDEVVHLKKSMLEK
MPGDKWQKFANLRLFYSYMYAHPGKKLLFMGGEFGQWSEWNATESLDWHLLNYKPHQKLL
KFVRDLNAIYQQNNALWEVDFDPQGFEWLDCNNHQKSIFSFIRKNKKENEIIVCVFNFRP
VVRENYKLGVPQAGTYNEILNTDSKIYGGQNIGNLGKLKSEPIECYQRKESINITLPPLS
GLYFKYQSQKEKKDGLKTR
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
ataatttcagatcaaaacaaaatcaataaactaataactggtaactgtaaagatccattt
gaaatattaggtatacatagattaaataaagaacaggtaattattagaatctttagacca
aaagtaaaaaaagctttcattatatctgatatcttagaaaatgatattaaactaaataaa
attaataaggaaggattttttgagaaagtaattaataaatcaaaattattcaattataaa
ttaaaattagagaatgagcaaggagagaaatggataactaaagatccttattcattttta
ccaattatatcagaatatgatttgcatttgtttaatgaggggaatcatcatcaaatctat
gaaaaaatgggagcacatataacaactaaaaaaggagtatcaggaactcatttctcagtt
tgggctccagaagctaaacgagtaagtgttgtaggagattttaataactgggatggtaga
gttcatcaaatgagaatgctaggagctagtggagtttgggagatctttattcctaatatc
acagaaggagagttatatcaatttgaaataaaaacaaaatcagatagagttttaatgaaa
tctgatccttatgctttttacagcgagttaagaccagcaaaggcctcaatcatatacgaa
ataaataataaacatgaatggaaagacgataaatggatgaaagaaagaaaagaaaaagaa
tggttaaaggaacctatatcaatttatgaagtcaacttaagttcctgggccaaagtccca
gaagaaaaaaatagatttttaacttatagagaattagctgaccaattagtaaactatata
aaacagaataactatacccatgttgaacttatgccgctagcagaacatccacttgatgaa
tcatggggttatcaaattacaggctacttttctgcaaccagtagatttggaaaaccagaa
gatttaatgtatttaatagatcaatttcaccaacataatattggagtaatcttagattgg
gtcccaggacactttcctaaagatgctcatggattaggaaggtttgatggatcagcacta
tatgaacacttagacccgttgctaggagaacatttaaagtggggaacctatatctttaac
catggtagaaatgaagttaaaaactttctaatatcaaatgctttattttggttagataag
tttcatatagatggcttaagagtagatgcagtatcatctatgatatacttagaccatggg
cgccaacactggagaacaaatgcatatggaggtacagaaaatttagcagccatagaattt
ttaaagtattttaattcaattactcataaatattacccaggaattttaactattgctgaa
gaagctacttcacgacctggaataactagccctacatattcagatggtctaggattttct
atgaagtggaatatgggatggatgcatgactcattagaatatatagaggcagaatctaca
catagaaaataccatcataataatctgacatttagtttgacgtatgcatttaacgaaaac
tatctattatctttatctcatgatgaagtagtacatctaaaaaaatcaatgctagagaag
atgcctggtgataaatggcaaaagtttgctaatttgcgcctgttttattcatatatgtat
gcccatccaggtaaaaaattattgtttatgggaggagaatttggtcaatggagtgaatgg
aatgctactgaaagtttggattggcatctcttaaattataaaccacaccaaaaattatta
aagtttgtccgtgatttaaatgctatttaccaacaaaataatgctttatgggaagttgat
tttgatccacaaggttttgaatggttagattgtaataatcatcaaaaaagcatcttctca
tttattagaaagaataaaaaagaaaatgaaataatagtctgtgtgtttaattttagacca
gttgtaagagaaaattataaattaggtgttcctcaagcaggtacttataatgagatatta
aatacagattctaaaatttatggagggcaaaatataggcaatttaggtaagcttaaatca
gaaccaatagaatgctaccaaagaaaggaatcaataaatattactctacctccattaagt
gggctttactttaaatatcagtcacaaaaggagaaaaaagatggacttaaaactagataa

DBGET integrated database retrieval system