KEGG   Halobacteroides halobius: Halha_1333Help
Entry
Halha_1333        CDS       T02401                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
hhl  Halobacteroides halobius
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Halha_1333
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halha_1333
   00600 Sphingolipid metabolism
    Halha_1333
Enzymes [BR:hhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Halha_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1336876..1339119
Genome map
AA seq 747 aa AA seqDB search
MGVFYNKAKQTFHLQTKGTSYVIKVLKSGHLGHVYWGKKIKKNRDLSHLIRHEERALEPY
LSPKNEDFHDESYSLDIIPQEYPAYGQTDYRQPAYHVELENGSRISDLRYQSHEIIKGKE
KLTGLPATYVEDKEEAKTLKITLQDKIANLKVSLSYTVYEKFNAITRSVKFVNKGKQNLN
LNRALSASVDFNNANFELLQLSGSWSRERHLKRRSLEHGIQAIESTRGASSPYQNPFLAL
VSEGANEDQGEAYGFSLVYSGNFLGQVQVNHFDQTRVNLGINPFDFNWLLEPKESFQAPE
VVMVYSDQGINQMSQTYHKLYRTRLARGEYRDKVRPILVNNWEATYFDFDEDKLLDLAET
ASDLGIELFVLDDGWFGKRDDDRSSLGDWFVDERKLPNGLDSLGEKIENLDMDFGLWFEP
EMISPDSDLYRAHPDWCIHVPERGRSKGRHQLILDLSRKEVQDKLIKMLSDILENAPISY
VKWDMNRHMTEIGSADLPPERQKELPHRYMLGLYRILEKLTTEFSDILFESCASGGGRFD
PGMLYYMPQTWTSDDTDAVERLKIQYGTSIVYPLSSMGAHVSAVPNHQTGRITSLDMRGD
VAKFGMFGYELDLTEMTNEEKKIIKEQIAEYKEIRELIQKGEFYRLISPFEGDGNLTAWM
VVAEDKSEAYVGCYRVLTKPNPKFYSLKLKGLNPEQNYKVVGTDKVYGGDELMYAGLNLP
EMFNGIDLSKMKGDFQSYVWRLRVIEN
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcttttataataaagctaaacaaacttttcatttacaaactaaagggactagt
tatgtgattaaagtattaaaaagtggtcacttaggtcatgtatattggggcaaaaaaatt
aaaaagaatagagatttatcccatttgattagacatgaagaaagagcattagaaccatat
ttgtctcccaaaaatgaagattttcatgatgaaagttattctttagatataattccacaa
gaatatccagcttatggtcagactgattatcggcaaccagcttatcatgttgaattagaa
aatggttcaagaattagtgatttaagatatcaatcacatgaaattattaaaggaaaagaa
aagttaacaggtttaccagctacttatgtagaggataaagaagaagcaaaaactttaaaa
ataactttgcaagataaaatagctaatttaaaagtctctcttagttatacagtttatgaa
aaatttaatgcaattactagatctgttaaatttgttaacaaaggtaaacaaaatttaaat
ttaaatcgagctttaagtgctagtgtagattttaataatgctaattttgagttgcttcaa
ttatcaggctcttggtctagagaaagacacttaaaaaggagatctttagaacatggaatt
caagctattgaaagcacaagaggggctagtagtccttatcaaaatccttttttagcatta
gtaagtgaaggagctaatgaagatcaaggagaagcatatggctttagcttagtctatagt
ggtaatttcttaggacaagtacaagttaatcactttgatcaaactagagtaaatttagga
attaatccttttgatttcaactggttattagaaccaaaagagagtttccaagctccagag
gtagtaatggtttactctgatcaaggaattaatcaaatgtcacaaacttatcataaattg
tatcgaacaaggttggctagaggtgaatatagagataaagttagaccaattttagttaat
aactgggaagcaacttactttgattttgatgaagataaactattagacttagcagaaact
gctagtgatttaggaattgaattatttgttttagatgatggttggtttggtaaacgagat
gatgataggtcatcgttaggagattggtttgtagatgaaagaaagcttcctaatggatta
gatagtttaggagaaaaaattgaaaatttagatatggactttggtttatggtttgagcca
gaaatgatttcaccagatagtgatttatatcgagctcatcccgactggtgtattcatgtg
ccagagagaggacgatctaaaggaagacatcagttgatattagatttatctagaaaagaa
gtacaagataaactgattaagatgttatctgatattttagaaaatgctccaattagttat
gttaagtgggatatgaatcgtcatatgacagagattggttcagccgaccttcctccagag
agacaaaaagaacttccacatcgctatatgttaggattgtatagaattttagaaaaatta
accacagaattctctgatattttatttgaaagttgtgctagtggagggggtagatttgat
ccaggaatgttatattatatgccacaaacctggactagtgatgatactgatgcagtagaa
agattaaaaattcaatatggaacaagtatagtctatccattaagctcaatgggagctcat
gtatccgcagtaccaaatcaccaaacagggagaatcacttctttagatatgagaggcgat
gtagctaaatttgggatgtttggctatgaattagatttaactgaaatgacaaatgaagaa
aagaaaattatcaaggaacaaatagcagagtataaggaaattagagagttaattcaaaaa
ggagaattttatagattaattagtccttttgaaggagatggcaacctaacagcgtggatg
gtagtagcagaggataaaagtgaagcttatgtaggttgttatagagtcttaactaaacca
aaccctaagttttatagtttaaaacttaaggggttgaatccagagcaaaattataaagta
gtaggcacagataaagtatatggtggagatgaattaatgtatgctggattgaatttacca
gagatgtttaatggaatagatctttctaagatgaaaggtgatttccaaagttatgtttgg
agattaagagtaattgagaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system