KEGG   Halobacteroides halobius: Halha_1372Help
Entry
Halha_1372        CDS       T02401                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hhl  Halobacteroides halobius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375896..1376900)
Genome map
AA seq 334 aa AA seqDB search
MKELVKKLVETYGPAGDEEEISRVIQTEIEDYVDQISKDPMGNLIALKKGQSADKKVMLA
AHMDEIGLIATHIDDDGFIRFSNVGGVSPHTLIGERVLFNGETVGVVDKEGKLEKISDLK
NSKMYIDIGASSKEEAKKKVKIGDTASYYRNLNDLGDRITAKSLDDRTGCAVLIKTLKEL
DQPTYDTYFVFTVQEEVGTRGSKVSAYGINPDLGIAVDVTLTGDMPEAKRMAVSLGAGPA
IKVKDATVLANPQVKEMMVKLAKKNEIPYQLEVLKRGGTDTGSIQLTRDGVLAGALSIPA
RHVHSPSEMVDINDLKNSVQLLRKILVSNYNNLI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagttaaaaaattagtagaaacctacgggccagcaggagatgaagaggaa
attagtagagttattcaaacagaaattgaagattatgttgaccaaattagcaaagaccct
atgggtaatttaattgcactaaagaaaggccaaagtgcagataaaaaagttatgttagca
gcacatatggatgaaattggattaatagctactcatattgatgatgatggttttatccgt
ttttctaatgtaggaggagtatctccccatacattaataggagagcgagttttatttaat
ggagaaacagttggagttgtagataaggaaggtaagttagaaaagattagtgatttgaaa
aattctaaaatgtatatagatattggtgctagtagtaaagaagaagctaagaagaaagta
aagataggagatacagcttcttattatcgaaatttaaatgatttaggtgatagaataact
gctaaatcattagatgatagaacaggttgtgcagtattgattaaaacacttaaagaatta
gaccaaccaacttatgatacctattttgtctttactgttcaagaagaagtaggaacacgt
ggttctaaagtttcagcttatggaatcaatcctgatttaggtattgctgttgatgtaact
ttaactggtgatatgccagaagctaaaagaatggcggtttcattaggagcaggtccagca
attaaagtaaaggatgctacagtgttagctaacccacaagttaaagaaatgatggttaag
ttagctaagaaaaatgaaattccttatcagttagaggtgttaaaaagaggaggtactgat
acagggagcattcaattaactagagatggtgttttagctggtgctctttctattccagcc
cgacatgttcattcaccatccgaaatggttgatatcaatgatctaaaaaatagtgtccaa
ttattaagaaaaatattagttagtaattataataatttaatctag

DBGET integrated database retrieval system