KEGG   Halobacteroides halobius: Halha_1773Help
Entry
Halha_1773        CDS       T02401                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hhl  Halobacteroides halobius
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Halha_1773
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Halha_1773
Enzymes [BR:hhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Halha_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1806354..1807823)
Genome map
AA seq 489 aa AA seqDB search
MINLKELVEVLEVEDTVGNLDIDITGIAYDSRKIRPGELFVAITGFEVDGHDFINGAIAN
GAQAVLVEKDIANKDVTTIKVSNTRKALARASAKFYDYPADDLTIIGVTGTNGKTTTTYL
IESVLDNLGLKTGLIGTIKNKVGTSIQGASRTTPESLDIQRFFAQMREEGVTHAVMEVSS
HALELGRVLEIDFDRQVFTNLSQDHLDFHQSLEDYLNAKLKLFTMNDKPAIINFDDQQAD
KIKEQARGEIISYGLEDEVDFKARDIKIDVKGVNYQLITKQNKLPVKLKLSGKFNVYNSL
AAIATVASLGFDLTEIKEGIEDICGVPGRFQLIDQGQDFGVIVDYAHTPDGMENVLKTAN
EFTTGRVIVVFGCGGDRDRKKRPIMGRLGVTLADFAIVTSDNPRSEDPMDIIADIMPGIN
ELEKKSGEDYIVIENRGEAINKAVEMANADDIILIIGKGHETYQDLGDKVIDFDDSEVAR
EALEYRSEE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgattaatctaaaagaattagttgaagtattagaagtagaagatacagtagggaatctg
gatattgatattacaggtattgcttatgattctcgtaaaataaggcctggagaactattt
gtagctatcacgggatttgaagtagatggtcatgattttataaatggtgctattgctaat
ggggctcaagcagtattagtagaaaaagatatagctaataaggatgttacaacaattaaa
gtgagtaatactagaaaagcattagctagggctagtgctaaattttatgattatccagct
gatgatttaactattattggagttacaggaactaatggtaagacaacaacaacttattta
attgagtctgtgttggataatttaggtcttaaaacaggattaattggaacgataaagaat
aaagtaggaactagtattcagggggctagtagaaccacccctgaatctttggatatccaa
agattttttgctcaaatgagggaagaaggagttactcatgcagtaatggaggtttcttct
catgctttagaattaggaagggtattagagattgactttgatcgtcaggtgtttactaat
ttaagtcaagatcaccttgattttcatcagtctttagaagattatttaaatgctaagctt
aaattatttacaatgaatgataaaccagcaattattaattttgatgaccaacaggctgat
aagattaaagagcaggctcgaggagaaattataagttatggtttggaagatgaagttgac
tttaaggctagagatattaagatagatgttaagggagttaactaccaattaataactaag
caaaataaattacctgttaaattaaagttaagtggtaagtttaatgtatataattcatta
gctgctattgcgactgtagctagtttaggttttgacttaactgagattaaggaaggaata
gaagatatctgtggtgttccaggcaggtttcaattaatagaccagggccaagattttgga
gtaattgttgattatgctcatactccagatgggatggagaatgttttaaaaacagctaat
gaatttactacaggacgtgtaattgtagtctttggttgtggaggagatcgtgatcgcaag
aaaagaccgattatgggtcgtttaggtgttactttagctgattttgctattgtaacctct
gataatccacgtagtgaagatccaatggatatcattgctgatataatgcctggaattaat
gagttagaaaagaaatcaggggaagattatattgttattgaaaatagaggagaagctatc
aataaggcagttgaaatggcaaatgcagatgatataatcttgattattggaaaaggtcat
gagacctatcaagatctaggagataaagtgatagattttgatgatagcgaggtagctaga
gaagctttagagtataggagtgaagaataa

DBGET integrated database retrieval system