KEGG   Halobacteroides halobius: Halha_2044Help
Entry
Halha_2044        CDS       T02401                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hhl  Halobacteroides halobius
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hhl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046538..2048031)
Genome map
AA seq 497 aa AA seqDB search
MDTYILSIDQGTTSSRAIVFDRDGKEVSVAQKEFTQHYPKAGWVEHDANEIWGTTIGVVA
DALGKADINPKQVEGIGITNQRETTVVWDVETGKPIHNAIVWQDRRTASICDELKEEGLA
EKIQEKTGLIIDAYFSGTKIKWILDNVEGARERAKEGKLRFGTIDSWLIWKLTGGNVHVT
DYTNASRTMIFNIHDLEWDEELLDILDIPKSMLPEAKSSSEVYGETIDYHFFGENVPIAG
IAGDQQAALFGQGCYEKGMAKNTYGTGCFLLMNTGQEAVKSENQLLTTIAASAESPKYAL
EGSIFIAGAAIQWLRDEIGLIEEAPDSEYFATKVDGTDGVYVVPAFTGLGAPYWDMYARG
TIVGLTRGTNKDHIIRATLESLAYQTRDVLQAMEADSGINLKELKVDGGAVANNFLMQFQ
ADILGTPVERPKYTETTALGAAYLAGLAVGYWDSKEEVLEKRRIDKTFSPDMNETKKEEL
YSGWQKAVGRSKDWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatacttatattctatctattgaccaagggacaactagttcaagagcaattgtattt
gaccgtgatggtaaagaggttagtgtagcccaaaaagaatttacgcaacactatcctaag
gcaggttgggtagagcatgatgctaatgaaatttgggggactactattggggtagtagca
gatgctttaggtaaagctgatattaatcctaaacaagttgaaggaataggtattactaat
caacgagaaactacggttgtgtgggatgttgagactggtaagcctattcataatgctatt
gtttggcaagatagaagaactgcaagtatctgtgatgaattaaaagaggaaggattagca
gaaaagattcaagaaaaaacagggttaataattgatgcttatttctctggaactaaaatt
aagtggattttagataatgtagaaggggctagagaaagagctaaagaaggaaaattaaga
tttggaactatagatagttggttaatctggaagttaacaggtggtaatgttcatgtaaca
gactatacaaatgcttcccgaactatgatttttaatatacatgatcttgagtgggatgaa
gagttacttgatatcttagatattccaaaatctatgttaccagaagcaaaatctagcagt
gaagtttacggagaaacaatagactatcacttctttggtgaaaatgtgccaatagctggt
atagcaggtgaccaacaggctgctttatttggtcaaggctgctatgaaaaaggaatggct
aaaaatacttacggaacaggatgtttcctattaatgaatacagggcaagaagcagttaaa
tcagaaaatcaattattaactactattgctgctagtgctgaaagtcctaagtatgctctt
gaggggagtatctttattgcaggagctgcaattcagtggctaagagatgagattggttta
attgaggaagctcctgattcagagtattttgctactaaagtagatggcacagatggagtt
tatgtagtaccagcctttactggtttgggggcgccttattgggatatgtatgctagagga
actattgtaggtttaacaagaggaactaataaggatcatataattagagctacgttggag
tctttagcttatcaaactagagatgtattacaagcaatggaagctgattcaggtattaat
cttaaagaattgaaagttgatgggggagcggtagctaataatttcttaatgcaatttcag
gcagatattttaggtacacctgtagaaagaccaaagtatactgaaactacggctttaggt
gctgcatatttagctggattagcagttgggtattgggatagtaaagaagaagtattagag
aaacgaagaatagataagacatttagtcccgacatgaatgaaactaaaaaagaagaactt
tattctggctggcaaaaggctgttggaagatcaaaagattgggcagaagagtag

DBGET integrated database retrieval system