KEGG   Halobacteroides halobius: Halha_2044Help
Entry
Halha_2044        CDS       T02401                                 

Definition
(RefSeq) glycerol kinase
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hhl  Halobacteroides halobius
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halha_2044
Enzymes [BR:hhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Halha_2044
Exosome [BR:hhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halha_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046538..2048031)
Genome map
AA seq 497 aa AA seqDB search
MDTYILSIDQGTTSSRAIVFDRDGKEVSVAQKEFTQHYPKAGWVEHDANEIWGTTIGVVA
DALGKADINPKQVEGIGITNQRETTVVWDVETGKPIHNAIVWQDRRTASICDELKEEGLA
EKIQEKTGLIIDAYFSGTKIKWILDNVEGARERAKEGKLRFGTIDSWLIWKLTGGNVHVT
DYTNASRTMIFNIHDLEWDEELLDILDIPKSMLPEAKSSSEVYGETIDYHFFGENVPIAG
IAGDQQAALFGQGCYEKGMAKNTYGTGCFLLMNTGQEAVKSENQLLTTIAASAESPKYAL
EGSIFIAGAAIQWLRDEIGLIEEAPDSEYFATKVDGTDGVYVVPAFTGLGAPYWDMYARG
TIVGLTRGTNKDHIIRATLESLAYQTRDVLQAMEADSGINLKELKVDGGAVANNFLMQFQ
ADILGTPVERPKYTETTALGAAYLAGLAVGYWDSKEEVLEKRRIDKTFSPDMNETKKEEL
YSGWQKAVGRSKDWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatacttatattctatctattgaccaagggacaactagttcaagagcaattgtattt
gaccgtgatggtaaagaggttagtgtagcccaaaaagaatttacgcaacactatcctaag
gcaggttgggtagagcatgatgctaatgaaatttgggggactactattggggtagtagca
gatgctttaggtaaagctgatattaatcctaaacaagttgaaggaataggtattactaat
caacgagaaactacggttgtgtgggatgttgagactggtaagcctattcataatgctatt
gtttggcaagatagaagaactgcaagtatctgtgatgaattaaaagaggaaggattagca
gaaaagattcaagaaaaaacagggttaataattgatgcttatttctctggaactaaaatt
aagtggattttagataatgtagaaggggctagagaaagagctaaagaaggaaaattaaga
tttggaactatagatagttggttaatctggaagttaacaggtggtaatgttcatgtaaca
gactatacaaatgcttcccgaactatgatttttaatatacatgatcttgagtgggatgaa
gagttacttgatatcttagatattccaaaatctatgttaccagaagcaaaatctagcagt
gaagtttacggagaaacaatagactatcacttctttggtgaaaatgtgccaatagctggt
atagcaggtgaccaacaggctgctttatttggtcaaggctgctatgaaaaaggaatggct
aaaaatacttacggaacaggatgtttcctattaatgaatacagggcaagaagcagttaaa
tcagaaaatcaattattaactactattgctgctagtgctgaaagtcctaagtatgctctt
gaggggagtatctttattgcaggagctgcaattcagtggctaagagatgagattggttta
attgaggaagctcctgattcagagtattttgctactaaagtagatggcacagatggagtt
tatgtagtaccagcctttactggtttgggggcgccttattgggatatgtatgctagagga
actattgtaggtttaacaagaggaactaataaggatcatataattagagctacgttggag
tctttagcttatcaaactagagatgtattacaagcaatggaagctgattcaggtattaat
cttaaagaattgaaagttgatgggggagcggtagctaataatttcttaatgcaatttcag
gcagatattttaggtacacctgtagaaagaccaaagtatactgaaactacggctttaggt
gctgcatatttagctggattagcagttgggtattgggatagtaaagaagaagtattagag
aaacgaagaatagataagacatttagtcccgacatgaatgaaactaaaaaagaagaactt
tattctggctggcaaaaggctgttggaagatcaaaagattgggcagaagagtag

DBGET integrated database retrieval system