KEGG   Halobacteroides halobius: Halha_2127Help
Entry
Halha_2127        CDS       T02401                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhl  Halobacteroides halobius
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halha_2127
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halha_2127
   00052 Galactose metabolism
    Halha_2127
   00500 Starch and sucrose metabolism
    Halha_2127
   00520 Amino sugar and nucleotide sugar metabolism
    Halha_2127
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halha_2127
   00524 Butirosin and neomycin biosynthesis
    Halha_2127
Enzymes [BR:hhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halha_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2126478..2127449)
Genome map
AA seq 323 aa AA seqDB search
MKQEYVIGIDLGGTKILTALADLEGNILAEVRKPTEADKGKNSVIAKIKDTIYEVLGQTE
VAIEEVEGIGLGSPGPLNIEEGIIYHTPNLNLDNVNIIEELKDVGPPIFLENDANAAALG
EKYFGAGKDAQDLIYVTVSTGIGGGIIIGGEVYHGASDGAGEIGHLTLLPNSDQKCGCGN
YGCWEAVASGTALSRLGREAVKNGEDTLLADLVDDATEVNGAVIAKAAKKGDQVASEIVE
QIAEYLGIGFASLINIFNPEKIIIGGGVSKSWPLLQDTVLANVEQRAMEALTAEVEIVTS
QLEDKIGVKGAIATALVGLKELS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaagaatatgtgattggtattgatctaggtggtactaagattttaactgcttta
gctgatttagaaggtaatatattagctgaggtaagaaagccaactgaagctgataaagga
aagaatagtgtaattgctaaaattaaggatactatttatgaagtattagggcaaacagag
gtagcaatagaagaagtggaaggaattgggttaggatcccctggtccgcttaatattgaa
gaaggaattatttatcatactcctaatctaaatctagataatgtaaatattattgaagaa
ttaaaggatgttggtcctcctatattcctggaaaatgatgctaatgcagctgcattagga
gaaaagtattttggagcaggtaaagatgctcaagatttaatttatgtaactgtaagtaca
ggaattggtggtgggattattattggtggtgaggtatatcatggtgctagtgatggtgct
ggagaaattggtcatttaaccttattgcccaatagtgatcaaaagtgtggttgtggtaat
tatggttgttgggaggcagtagcttctggaacagcattaagcagattagggcgtgaagct
gtcaaaaatggtgaagatactttattagctgatttagtagatgatgcaactgaggttaat
ggagctgtgattgctaaagcagctaaaaaaggagatcaagtagcttctgaaatagtagag
caaatagcagagtatttagggattgggtttgctagtttaatcaatattttcaatccagaa
aaaataatcattggtggaggagtatcaaagtcttggcctctattacaggatactgttttg
gctaatgttgaacaaagagctatggaagcgttaactgctgaagtagaaattgtcacttct
cagttagaggataaaataggagtaaaaggagctattgcgacagctttagtaggcttaaaa
gaattgtcttaa

DBGET integrated database retrieval system