KEGG   Halobacteroides halobius: Halha_2365Help
Entry
Halha_2365        CDS       T02401                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hhl  Halobacteroides halobius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Halha_2365
   00052 Galactose metabolism
    Halha_2365
   00500 Starch and sucrose metabolism
    Halha_2365
   00520 Amino sugar and nucleotide sugar metabolism
    Halha_2365
Enzymes [BR:hhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Halha_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2369781..2370692)
Genome map
AA seq 303 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDQPTIQYIVEEAVQSGIEELIIITGRH
KRAIEDHFDKNLELEMALERKGKDDMLETVQDISNLINVHYVRQKEPKGLGHAILQAKTF
IGNEPFAVLLGDDIVKAQKPVTKQLIEAFAEKESSIIGVQKVADEVVNKYGIVDYDQQED
DLYKVDNLVEKPALEEAPSNIAILGRYILTPEIFTILENTPPGKGNEIQLTDALESLLAQ
DEIYARVFTGKRYDIGNKLGFLKATVEFALSREDIKDDFSNYLAELLSQDPQTLQKIAAA
QEE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggttagaaaagcagtaattccagcagcaggattagggactagatttctccca
gcaactaaagcacaacctaaggaaatgttaccaattgttgatcagccaacgattcagtat
attgttgaagaagcagttcagtcaggtattgaagagttaattattattactggtcgccat
aaacgggctattgaagatcactttgataaaaatttagagctagagatggctttagagaga
aaaggtaaggatgatatgttagagacagtccaggatatctctaatttgattaatgttcat
tatgtgcgccaaaaagagcctaaaggcctaggacatgctattttacaggcaaagaccttt
attggtaatgagccatttgcagttttattaggtgatgatattgtaaaggcccaaaagcct
gtcactaaacagttaattgaagcctttgcagaaaaagaatctagtatcattggggtccaa
aaagtggctgatgaagtagttaataagtacggaattgttgattatgatcagcaagaggat
gatttatataaggtggataatttagtagagaagccagctttagaggaagcaccatctaac
attgctattttaggtcgctatattttaacgccagaaatctttactattttagagaatacg
ccacctggtaaaggcaatgaaatccagttaactgatgctttagagagcttgttggctcaa
gatgagatctatgctagagtatttacaggaaagagatatgatattggtaataaattaggc
tttttaaaggctacagttgaatttgctttatcgcgagaagatattaaagatgactttagc
aattatttagctgaattattaagtcaagatccccagacactccaaaaaatagcagcagct
caagaagaataa

DBGET integrated database retrieval system