KEGG   Helicobacter heilmannii: BN341_p0932Help
Entry
BN341_p0932       CDS       T02626                                 

Definition
Catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hhm  Helicobacter heilmannii
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hhm00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hhm00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(901803..902756)
Genome map
AA seq 317 aa AA seqDB search
MRPLACVCLPLLMFSLAHAKEVYDAQKIADLFYQLNGDTKNPHKKINHAKGFCAAGVFVP
SEDSRLDIPLLEQRSIPTEVRYSLGGGNLHASDKSKSRGMALRIGKDSDWVIVMTNAPIN
FAKNPEEFGHFLELRIPKNGHVDQARIKKATQEVESFRNFAHYMAGIGVTRSVANTRYYS
THTFYFKDKNTQRFLPARFSFVPVAGVHDLTHAELKRVGNDFLEKDFEEKVAKAPIVYDM
VLELANKNDPTNDTTKLWHGKHEQITIGQLKVQAYKGHGCNGEVFMPGMLPSGVEPPKDP
LFNLRNEVYSITFSKRQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctcttgcttgcgtgtgcttgcccttgcttatgttctctttagcccatgctaaa
gaagtctatgatgcgcaaaaaatcgccgacttgttttaccagctcaatggcgacaccaaa
aacccccataagaaaatcaaccatgccaagggcttttgcgcggcaggcgtgtttgtgccc
agcgaggactctaggctagacatcccgcttttagagcaaaggagtatccccacagaggtg
cgctactctcttggcgggggcaacttgcatgccagcgacaaatccaaatcacggggcatg
gctttaaggataggcaaagatagcgattgggtgatcgtgatgaccaatgcccccatcaac
tttgccaaaaaccccgaagagtttgggcactttttagagctgcgcatccctaaaaacggg
catgtggatcaagcccggatcaaaaaagcaacccaagaggtggagagttttagaaacttc
gcccactatatggcaggcattggggttactaggagtgttgctaacacccgctactactcc
acgcacaccttttacttcaaggacaagaacacccaacgcttcttgcccgcccgctttagc
tttgtccctgtggccggggtgcatgacctaacccatgcggagttaaagcgtgtgggcaac
gactttttagaaaaggactttgaagaaaaagtcgccaaagcccccattgtctacgacatg
gttttggagctggccaataaaaacgaccccaccaacgacaccaccaaactatggcatggc
aagcacgagcaaatcaccatcgggcaacttaaagtgcaagcctacaaggggcatgggtgc
aatggcgaagtgtttatgccgggtatgttgcctagtggggtagagccgcccaaagacccg
ctttttaacctacgcaacgaggtgtactccatcaccttttctaagcgtcaatga

DBGET integrated database retrieval system