KEGG   Helicobacter heilmannii: BN341_p1004Help
Entry
BN341_p1004       CDS       T02626                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hhm  Helicobacter heilmannii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN341_p1004
Enzymes [BR:hhm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN341_p1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
833078..833500
Genome map
AA seq 140 aa AA seqDB search
MDVGIHASIYRHFTEARFIAYGRPPHAIAYSLNHESLAPRDYLGATLLGQKIDIYDPKSY
KDWQDRCSVDISHYLQASKRCFIFIRGCGIVAYHRELQGLLKIFDLIEGGCEILQLSNPN
PQGEIVPKKEQTLEPSPSQN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaggcatccacgctagtatttaccgccacttcacagaagcccgcttcatcgcc
tatggtcgccccccacacgccatcgcttattcgcttaaccacgaatctttagcccctaga
gattacttaggtgccacgcttttagggcaaaaaattgacatttacgatcccaagagctat
aaagactggcaggatcgttgctccgtggacatttcacactacttgcaggcgagcaagagg
tgctttattttcatcagggggtgcggaatcgtggcctaccatagggaactacaaggctta
ttaaaaatttttgatttgattgaggggggttgtgagattttgcaactatcaaacccaaac
ccccaaggggagattgtgcccaaaaaagaacaaaccctagagccaagccctagccaaaac
tag

DBGET integrated database retrieval system