KEGG   Helicobacter heilmannii: BN341_p1299Help
Entry
BN341_p1299       CDS       T02626                                 

Definition
NADP-specific glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
hhm  Helicobacter heilmannii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hhm00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hhm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hhm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
578049..578264
Genome map
AA seq 71 aa AA seqDB search
MAVSGLEMAQNASLHTWSFEVVDQKLRTIMRDIFNNSAQTAAEFKDPTNLVLGANIASFR
KVAQAMIDQGY
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtgagtggactagagatggcgcaaaatgccagcttacacacttggagctttgag
gtggtggatcagaaattgcgcacaatcatgcgagacatctttaacaacagcgcgcagacc
gccgccgagtttaaagaccccacgaacttggttttgggtgcaaacattgccagttttaga
aaagtcgcccaagcgatgatcgatcaagggtattaa

DBGET integrated database retrieval system