KEGG   Helicobacter heilmannii: BN341_p1299Help
Entry
BN341_p1299       CDS       T02626                                 

Definition
NADP-specific glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
hhm  Helicobacter heilmannii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhm00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BN341_p1299
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN341_p1299
   00330 Arginine and proline metabolism
    BN341_p1299
Enzymes [BR:hhm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     BN341_p1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
578049..578264
Genome map
AA seq 71 aa AA seqDB search
MAVSGLEMAQNASLHTWSFEVVDQKLRTIMRDIFNNSAQTAAEFKDPTNLVLGANIASFR
KVAQAMIDQGY
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtgagtggactagagatggcgcaaaatgccagcttacacacttggagctttgag
gtggtggatcagaaattgcgcacaatcatgcgagacatctttaacaacagcgcgcagacc
gccgccgagtttaaagaccccacgaacttggttttgggtgcaaacattgccagttttaga
aaagtcgcccaagcgatgatcgatcaagggtattaa

DBGET integrated database retrieval system