KEGG   Helicobacter heilmannii: BN341_p1583Help
Entry
BN341_p1583       CDS       T02626                                 

Definition
Catalase (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hhm  Helicobacter heilmannii
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN341_p1583
  Amino acid metabolism
   00380 Tryptophan metabolism
    BN341_p1583
Enzymes [BR:hhm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BN341_p1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
319736..320587
Genome map
AA seq 283 aa AA seqDB search
MINEKNERFWAKFHFKTLQGIKNLTSEEAAKIRMHDMDSHQRDLFEAIENKDFPKWRFCM
QIMPESDAKNYQFHPFDVTKVWSHKDYPLIEVGILELNKNPENYFAEVEQSAFNPAHVIP
GVGYSPDRMLQGRLFAYGDTQRYRLGINHSQLPVNAPKCPFATSSRDGFMTNGHYGAMRN
YDPSSLPGYKEAPHAKEPKLELAKLADEMAVYAYNFRDYDNDYYTQPGDLFRLMPKDEQE
RTCQNVADAMKGVPNDIVSRQLEHFKKADAHYGQRIQKLLQKH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaatgagaaaaacgaacgtttttgggcaaaattccactttaaaactctgcaaggg
atcaaaaacctcaccagcgaagaggcggctaaaatccgcatgcacgacatggactcgcac
caacgggatttatttgaagccattgaaaataaagacttccccaaatggcgtttttgcatg
caaatcatgccagagagcgatgccaagaactatcaattccacccctttgatgtaaccaag
gtgtggagccataaagactatcccttgatcgaagtaggtattttggagctgaataaaaac
cctgaaaactactttgccgaagtggagcaatccgctttcaaccccgcccatgtgatcccg
ggcgtgggttatagccccgatcggatgctacaagggcggctctttgcttatggggatacg
cagcgctaccgcctagggatcaaccacagccaattacccgtgaatgcccccaaatgcccc
tttgccacctcttcacgcgacggcttcatgacaaacgggcactacggcgcgatgcgcaat
tatgatccaagctcactgcccggctacaaagaagccccgcacgccaaagagcccaagctt
gagctagccaaacttgccgatgaaatggccgtctatgcctacaacttcagagattatgac
aacgattactacactcagcctggcgatctctttagattgatgcctaaagatgaacaagag
cgtacttgccaaaatgttgccgatgctatgaaaggtgtgcctaatgacatcgttagccgt
caattggagcacttcaaaaaggcagatgcacactacggacaacgcattcaaaaattgttg
caaaagcactag

DBGET integrated database retrieval system