KEGG   Helicobacter heilmannii: BN341_p1768Help
Entry
BN341_p1768       CDS       T02626                                 

Definition
disulphide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hhm  Helicobacter heilmannii
Brite
Enzymes [BR:hhm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BN341_p1768
Secretion system [BR:hhm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BN341_p1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
155351..156112
Genome map
AA seq 253 aa AA seqDB search
MRRLFCALSLCVGFVGAVESKAGQAVADLIDKQIHKKVNVLEVKSLKSNKDFQVVVVEDP
DTKYKIPLLVNKNGDLVIGLTNIFFSKSKQDTEFIQELYHNTQSYNFAQQNSAALNALFE
GLPKGYAIDLKSTTPGVKKNLYIISDPMCPHCHHELEQIDKRLKEANVHMVLVGFLGHEA
MLKAADILKQVKKARNTKEKVSLLQKVYAYNYKPSDVPDDKVQEVEKVTKTIEDTKLVKG
VPFIYDYHKAAGK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagattgttctgtgctttgagtttgtgtgtggggtttgtgggggcggttgagagt
aaggcggggcaggcggtggcagacctcattgacaaacagatccacaaaaaagtcaatgtt
ttggaggtgaagtccttgaagtctaataaagactttcaggtggtggtggtcgaagacccc
gacacgaaatataaaatccccttgttggtgaataaaaacggggacttggtgattggtctg
accaatatcttttttagtaagagcaaacaagacaccgaatttattcaagagctttaccac
aacactcaaagctacaacttcgcccaacaaaacagcgcggctttaaatgccctttttgaa
ggcttgcccaagggctacgccatcgatctaaaatccaccacccccggggtgaaaaagaac
ctctacatcatctccgatcccatgtgcccgcactgccaccacgaattggagcagatcgac
aaacgcttgaaagaagccaatgtgcatatggtgcttgtgggctttttagggcatgaagcc
atgctcaaagccgccgacattttaaaacaagtcaaaaaagcccgcaacaccaaggagaaa
gtgagcttgttgcaaaaagtctatgcctacaattacaaaccctccgatgtccccgatgac
aaagtccaagaggtggaaaaggttactaaaacaattgaggacaccaagttagtcaagggc
gtgcccttcatctatgactaccataaagcggccggcaagtag

DBGET integrated database retrieval system