KEGG   Haloarcula hispanica N601: HISP_06540Help
Entry
HISP_06540        CDS       T02949                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hhn  Haloarcula hispanica N601
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HISP_06540
   00500 Starch and sucrose metabolism
    HISP_06540
Enzymes [BR:hhn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     HISP_06540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1239134..1240219)
Genome map
AA seq 361 aa AA seqDB search
MDDARAAVIALLLSAVLTLAVVPASVAGTQTAQETLTVDKDGSADYRSIQAAVDAADSGD
TVEVRPGTYYEEVRINENISLVAPDRAILDGSRFVNGTGVTVAGPAEPTVTGFTVRNYRF
GVMANGTNGDWTVSNTTVIAADVGVYAPNSSGNWTIEDAAVASTTYSGVFARETSGDWTI
RDTRFVAVGGDGADVRRSSGDWAVAAVVVDRSGADGVDASGTTGDWTVQNTEVRRSDTGV
KAIDSDGDWTVTDLTVRRSDTGLVTAFSGGAWTLENATLETRDIGVFSARTTGAWTIQNT
IIESRQQGIHAVKTNASWTVSESTVSVTAEQNAIGVDARSASEGWSLENVTIDSPDIKVA
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcacgagcagcagtaattgccctcttgctgtcggcagtgctgaccctcgcc
gtggtaccggcaagcgtagcaggaacacagacggcacaggagacactaaccgtcgacaaa
gacgggagtgccgactaccggtcgatacaggccgccgtggacgccgccgatagcggtgac
accgtcgaggtccggccgggcacctactacgaagaagtccgaatcaacgagaacatctcc
ctcgtcgcacccgaccgggcgatactggacggctcgcggttcgtcaacggtaccggcgtt
acggtggccggcccagccgaaccgaccgtcaccggatttaccgtgcggaactaccgcttt
ggtgtcatggccaacgggaccaatggcgactggacggtcagtaatacgaccgttatcgct
gccgacgtcggcgtctacgcgccgaattcgtccgggaactggactatcgaggacgccgcc
gtcgccagcacgacctacagcggcgtgttcgcccgcgagaccagcggcgactggacgatt
cgcgacactcgcttcgtcgctgtcggcggcgacggcgccgacgtccgcaggtcttccggc
gactgggcggtcgcagcggtcgtcgtcgaccggtccggcgcggacggcgtcgatgcctcc
gggacaactggcgactggacggtccagaacacggaggtccgtcgtagcgataccggcgtc
aaagctatcgacagcgacggcgactggacggtgaccgacctgacggtccgccggagcgac
accggcctggtgaccgctttctcgggcggtgcgtggacgctcgaaaatgccaccctcgaa
acccgggatatcggggtcttcagcgctcgaacgaccggcgcgtggaccatccagaatacg
atcatcgaaagccggcaacagggaatccacgccgtcaagaccaacgcgtcgtggactgtc
tctgaatcgaccgtctccgtgaccgccgagcagaacgccatcggtgtcgacgcccgctcc
gcgagcgagggctggtcgcttgagaacgtcaccatcgacagccccgatatcaaagtcgcc
gagtga

DBGET integrated database retrieval system