KEGG   Haloarcula hispanica N601: HISP_06540Help
Entry
HISP_06540        CDS       T02949                                 

Definition
(GenBank) pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00040  Pentose and glucuronate interconversions
hhn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HISP_06540
Enzymes [BR:hhn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     HISP_06540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NosD Beta_helix DUF1565 DUF5123 Bac_rhamnosid_N
Motif
Other DBs
NCBI-ProteinID: AHB65681
UniProt: V5TK35
Position
1:complement(1239134..1240219)
Genome map
AA seq 361 aa AA seqDB search
MDDARAAVIALLLSAVLTLAVVPASVAGTQTAQETLTVDKDGSADYRSIQAAVDAADSGD
TVEVRPGTYYEEVRINENISLVAPDRAILDGSRFVNGTGVTVAGPAEPTVTGFTVRNYRF
GVMANGTNGDWTVSNTTVIAADVGVYAPNSSGNWTIEDAAVASTTYSGVFARETSGDWTI
RDTRFVAVGGDGADVRRSSGDWAVAAVVVDRSGADGVDASGTTGDWTVQNTEVRRSDTGV
KAIDSDGDWTVTDLTVRRSDTGLVTAFSGGAWTLENATLETRDIGVFSARTTGAWTIQNT
IIESRQQGIHAVKTNASWTVSESTVSVTAEQNAIGVDARSASEGWSLENVTIDSPDIKVA
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcacgagcagcagtaattgccctcttgctgtcggcagtgctgaccctcgcc
gtggtaccggcaagcgtagcaggaacacagacggcacaggagacactaaccgtcgacaaa
gacgggagtgccgactaccggtcgatacaggccgccgtggacgccgccgatagcggtgac
accgtcgaggtccggccgggcacctactacgaagaagtccgaatcaacgagaacatctcc
ctcgtcgcacccgaccgggcgatactggacggctcgcggttcgtcaacggtaccggcgtt
acggtggccggcccagccgaaccgaccgtcaccggatttaccgtgcggaactaccgcttt
ggtgtcatggccaacgggaccaatggcgactggacggtcagtaatacgaccgttatcgct
gccgacgtcggcgtctacgcgccgaattcgtccgggaactggactatcgaggacgccgcc
gtcgccagcacgacctacagcggcgtgttcgcccgcgagaccagcggcgactggacgatt
cgcgacactcgcttcgtcgctgtcggcggcgacggcgccgacgtccgcaggtcttccggc
gactgggcggtcgcagcggtcgtcgtcgaccggtccggcgcggacggcgtcgatgcctcc
gggacaactggcgactggacggtccagaacacggaggtccgtcgtagcgataccggcgtc
aaagctatcgacagcgacggcgactggacggtgaccgacctgacggtccgccggagcgac
accggcctggtgaccgctttctcgggcggtgcgtggacgctcgaaaatgccaccctcgaa
acccgggatatcggggtcttcagcgctcgaacgaccggcgcgtggaccatccagaatacg
atcatcgaaagccggcaacagggaatccacgccgtcaagaccaacgcgtcgtggactgtc
tctgaatcgaccgtctccgtgaccgccgagcagaacgccatcggtgtcgacgcccgctcc
gcgagcgagggctggtcgcttgagaacgtcaccatcgacagccccgatatcaaagtcgcc
gagtga

DBGET integrated database retrieval system