KEGG   Haloarcula hispanica N601: HISP_06960Help
Entry
HISP_06960        CDS       T02949                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hhn  Haloarcula hispanica N601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1321557..1322858)
Genome map
AA seq 433 aa AA seqDB search
MNRPRITGSKQASRRTVLKGIGVLGAAVFGTAASVGSSAAVGDSAVYQYYHTDWTEITAT
LETVAQQGYDAIQVPPAQRSRLDRSHQNGVTDPPLGYQPVDLTDFNSVFGTEDEYEAMVQ
EAHNQDLDVVADAVINHMAANDDFRDAPGITFADLPRFSERDFHPKDDINYDNPESVEDD
WLVGLKDLKQESAYVRGELQAYVQKYADLGVDGIRWDAAKHVPESFFADYANQWADDLDL
WTVGEVLDGDIGVCQGYADTGMSVTDYPLYYTMKEEAFHSDGNMQALDGAGMVNQSPFQA
FTFVSNHDSGPPDYEKLAYAYILTYEGYPRVYSNRISVDDDDIRNLLWIRNNLASGGSQT
RHVDQDLYVYEREGNLLVGLNRASGQRSKWVPTSWTNQTLNDYSGNAGNISTNGDSWVQI
TVPATSWVCYAPE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaccccgaattaccggcagtaagcaggcgtctcggcgaaccgttctgaaagga
atcggagtgctcggtgccgcagtattcggcaccgccgcctcagtcggcagtagcgcggct
gtcggcgatagcgcggtgtaccagtactaccacacagactggacagagatcacagcgacg
ctggaaacagtcgcacaacagggctacgacgcgattcaggtcccaccggcccagcggagc
cgcctcgaccggagccatcagaacggcgtcaccgacccaccgcttggctatcagcccgtc
gacctgacggatttcaacagcgtgttcggcacagaggacgagtacgaggcgatggtgcag
gaggcccacaatcaggacctcgacgtcgtcgccgacgcggtcatcaaccacatggccgca
aacgacgacttccgggacgcgccgggcattaccttcgcggacctcccccggttcagcgaa
cgcgacttccacccgaaagacgacattaactacgacaacccggaatcggtcgaggacgac
tggctcgtcgggctgaaggacctgaaacaggagtccgcgtacgtccgcggcgagttgcag
gcctacgtccagaagtacgcggacctcggcgtcgacggtattcgctgggacgccgccaaa
cacgtccccgagtcgtttttcgccgactacgcgaaccagtgggccgacgacctcgatctc
tggacagtgggtgaggtgctcgacggcgatatcggcgtctgccaagggtacgccgacacg
gggatgtccgtcaccgactacccgctctattacacgatgaaagaggaggcgttccacagc
gacggcaacatgcaggcgctcgacggcgccggcatggtgaatcagtcgccgttccaggcg
tttacgttcgtttcaaaccacgacagcgggccgccggactacgagaaactcgcgtacgcc
tacatcctcacgtacgaggggtatccacgcgtgtacagcaaccgtatcagcgtcgacgac
gacgatatccggaacctcctctggatccggaacaacctcgcgagcggcggctcacagacc
cgccacgtcgaccaggacctgtacgtctacgagcgagaggggaacctcctcgtcggcctg
aaccgtgcgagcggccagcggagcaagtgggtccccacgagctggacgaaccagacactc
aatgattacagcggcaacgcgggcaatatctcgaccaacggcgatagttgggtccagatc
accgttcccgcgacaagttgggtctgctacgcacccgagtag

DBGET integrated database retrieval system