KEGG   Haloarcula hispanica N601: HISP_08175Help
Entry
HISP_08175        CDS       T02949                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hhn  Haloarcula hispanica N601
Brite
Enzymes [BR:hhn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HISP_08175
Transfer RNA biogenesis [BR:hhn03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HISP_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1549625..1551280)
Genome map
AA seq 551 aa AA seqDB search
MSTETPDPDETETFQQVCAELVDRILAGEVERDDVESAKIDVCREYSAPKVPKNSELLDY
APQEHREVLEEVLQRKPVRTASGVSPIAIMTSPERCPHGKCLYCPGGPDSEFSSAQSYTG
HEPAAARGEQNDYDPYGQVTLRLNQLREIGHPVDKAELIVMGGTMTARSHDYQEWFVKRA
LEAMNDFDVDSEPTPAEDVSFAEDDYEFRYLEDVIAENETADVRNVATTFETKPDWCDPE
QIDRMLDLGGTKVEVGVQTTFERINREMHRGHGVQASIDANRRLRDSGFKVGFHMMPGQP
GMSKEMCLEDFRRIFDQTDWRPDYLKIYPTLIVEGTVTYDWWRNDEFDPLSNDEAAELVA
EIKDMIPRYTRLQRVQRDIPADFIEGGVWKSNLRQLAWQRMEEHDWTCDCIRCREAGHSD
DAAENIELDVMTYEACGGTEHFISFEDFDNDVLVGFCRLRFPNDPVRRELQDAAIVRELH
VYGNAVGVGQEGDDEDHQHKGYGKKLLEKAETLARDAGYPKLAVISGIGVRQYYREKLGY
KQDGPYVSKRL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagacgccggacccagacgagacagagaccttccagcaggtgtgtgcggag
ctggtcgaccggattctcgcaggcgaggtcgagcgcgacgacgtcgaatcggccaagata
gatgtctgtcgagagtattccgcgccgaaagtgccgaaaaactccgaactgctcgattac
gcgccacaggagcaccgcgaggtgctggaggaggtcctccagcgcaagcccgttcggact
gcctcgggtgtctcccctatcgctatcatgacctcacccgagcggtgtcctcacgggaag
tgcctgtactgtccgggcggcccggattcggagttctcctccgcgcagtcctacaccggc
cacgagcccgcggccgcacgcggcgaacagaacgactacgacccctacggccaggtcacc
ctccggctcaaccaactgcgggaaatcggccatcctgtcgacaaggccgaactcatcgtg
atgggcgggacgatgacggcccggagccacgactaccaggagtggttcgtcaagcgggcc
ctggaggcgatgaacgacttcgacgtggattcggagccgacgcccgcggaggacgtgagc
ttcgccgaggacgactacgagttccgctatctggaagatgtcatcgcggaaaacgagacc
gctgacgtccgcaacgtcgccaccacgttcgagacgaagccggactggtgtgatccggaa
cagatcgaccggatgctcgacctcggcgggacgaaagtcgaggtcggcgtccagacgacc
ttcgagcggatcaaccgcgagatgcaccgcggccacggcgtgcaggcctctatcgacgcc
aaccgccgcctgcgcgattcggggttcaaggtcggcttccacatgatgccgggccagccc
gggatgtccaaggagatgtgtctggaggacttccggcgcatcttcgaccagacggactgg
cggcccgactacctcaagatatacccgacgctgattgtcgagggaaccgtcacatacgac
tggtggcgcaacgacgagttcgacccgctttccaacgacgaggccgccgaactggtcgcc
gaaatcaaggacatgattccccgctacacccgcctccagcgcgtccagcgggacatcccg
gcggacttcatcgagggcggcgtctggaagtcgaacctccgccagctcgcctggcagcgg
atggaagagcacgactggacgtgtgactgtatccgctgtcgggaggccggacacagcgac
gatgccgccgagaacatcgaactcgacgtgatgacctacgaggcctgtggcggcacggag
catttcatctccttcgaagacttcgacaacgacgtgctcgtcgggttctgtcggctcaga
ttccccaacgatccggtacgccgggagctacaggacgccgcaatcgtccgcgaactccac
gtctacggcaacgccgtcggcgtcggtcaagagggtgacgacgaggaccaccagcacaaa
ggctacggcaagaaactgctggaaaaagcggaaacactggcacgggacgccggctacccg
aaattggccgttatttccggtatcggcgtccggcagtactaccgggagaagctggggtac
aagcaggacggcccatacgtgagcaagcgtctctga

DBGET integrated database retrieval system