KEGG   Hydrogenobaculum sp. HO: HydHO_0022Help
Entry
HydHO_0022        CDS       T02482                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HydHO_0022
Enzymes [BR:hho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HydHO_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(21909..22457)
Genome map
AA seq 182 aa AA seqDB search
MIDKEKIIQGIKLFLEGIGEDITREGIKETPERVARMWEEFEKERSFDFKLFEEYSNYSE
MIIVKDIPFYSMCEHHLLPFFGKAHIAYIPNKKICGLSKLVRTVRAMALKPQVQERLTEE
IADIVQKELEPMGAGVVIEAEHLCMSMRGVRSPGHCTVTSSLRGSFLSDIRTKEEFFKLI
RQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaaagaaaagatcatacaaggtataaagcttttcttagaaggtataggagaa
gatatcacaagagaaggcataaaagaaaccccagaaagagtcgctaggatgtgggaggag
tttgaaaaagagagatcctttgattttaagctttttgaagagtacagcaactattctgaa
atgattatcgtaaaagatatacctttttatagtatgtgcgagcatcatcttttaccattt
tttggaaaagctcatatagcctatataccaaacaaaaagatatgtgggctatctaaactt
gtaagaactgtaagggctatggctttaaaaccacaagtccaagaaagacttacagaggaa
atagccgatatagtccaaaaagaattagaaccaatgggagctggtgtcgtaatagaggca
gagcatctttgtatgtctatgagaggagtaagatcaccaggacattgcaccgtcacttcc
tctttaaggggaagctttttaagcgatattagaacaaaggaggagtttttcaaacttata
agacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system