KEGG   Hydrogenobaculum sp. HO: HydHO_0034Help
Entry
HydHO_0034        CDS       T02482                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hho  Hydrogenobaculum sp. HO
Brite
Enzymes [BR:hho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HydHO_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31063..31887)
Genome map
AA seq 274 aa AA seqDB search
MDLSIKSNNERAVLLLHGLTGTPLELRWVARDFAKANYDVYFPILPGHCSSLEDLKKTKW
EELYEFAKNFYLDLKAKYNQVFVAGLCVGGMLSLMLGMEFPDIDGVGSWAPAMDIDGWAI
PWYRFLLPLGLYTPLKHIYYWKEKEPFGIKNEAMRRKIMQMMKAEKNEAMAYDKIPAPTI
VELKRMAKYIKKHVNLLKAPFILIHSKEDDLSSIKGAKYIYEKAPSQVKKFVELSNSYHI
VTMDNEKDIVSGETINFFNFLTEIKRQKLEVYQV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggatctttctataaaaagcaacaacgaaagagcagtgttgcttcttcacggacttact
ggtacacctttagagctaagatgggtggccagagattttgccaaggcaaattacgatgta
tattttccaatactacctggtcattgttctagccttgaagatcttaaaaaaaccaaatgg
gaggagctttacgagtttgccaaaaatttttatcttgatttaaaagctaaatacaaccaa
gtatttgtggctgggctatgcgtaggcggtatgctctctcttatgcttggtatggagttt
cctgatatagacggtgttggctcttgggcaccagcaatggatatagatggatgggcaata
ccttggtatagatttttactaccacttggactttatacaccgttaaaacatatttactat
tggaaagagaaagaaccctttggcataaaaaatgaagccatgagaagaaaaatcatgcag
atgatgaaagctgaaaaaaatgaagccatggcatacgataaaataccagctcccactata
gtagaactaaaacgaatggctaaatatattaaaaagcatgtaaatctcttaaaagcaccg
tttatcttaattcattcaaaagaagacgacttatcttctataaaaggggcaaagtatata
tacgaaaaagctccaagtcaggttaaaaagtttgtagaactttcaaacagctatcacatc
gtgactatggacaacgaaaaagacatagtttcaggtgaaacaataaattttttcaacttt
ttaacagaaataaagcgtcaaaagttagaagtgtatcaggtgtaa

DBGET integrated database retrieval system