KEGG   Hydrogenobaculum sp. HO: HydHO_0604Help
Entry
HydHO_0604        CDS       T02482                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hho00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537279..539171
Genome map
AA seq 630 aa AA seqDB search
MAYKYNYDISLLTDEDLYLFNEGTHYHLYEKLGAHVLEGGVYFAVWAPNAKEVYVEGSFN
FWNKKEYPLRPKGSSGIWEIFIEDLKSYELYKYYIVSNFGYELEKRDPFAFYTEVPPKSA
GIIYDISGYQWKDESWLLKRKNSNHYKEPISIYEVHLGSWRRTLENGFLSYKDIAHQLVE
YVKDMGFTHVEFLPIMEHPFYGSWGYQTLSYFAPTSRYGEPKDFMYLVDFLHQNDIGVIL
DWVPSHFATDDYGLSFFDGTHLYEHMDKRKGYHPDWGSYIFNYGRHEVRAFLISSANFWF
DKYHVDGIRVDAVASMLYLDYSRKEGEWEPNIYGGKENLEAIDFLRKLNETVYIFNPGIF
TVAEESTAWPMVTKPTYIGGLGFGFKWDMGWMHDTLRYFSKDPIHRKYHQQDITFRMLYA
FNENFILPLSHDEVVHGKGSLIGKMPGDYWQKFANLRLLLSYMYGSPGKKLLFMGSEFGQ
FDEWNHDKSLDWHLLEFDSHKGIQNLVRDLNKIYKNETALHELDHDPEGFEWIDFQDVEQ
SIFSFLRKAKNGDFVICIFNATPVPRHDYKIGVPKPGFYKEILNSDSIYYWGSNVGNAGL
IEAHAEPWHKFNFSISLTLPPLGALFLKLA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaatacaattacgatataagccttttaaccgacgaagatttgtatcttttc
aacgaagggacacattatcatctttatgaaaagcttggggcccatgtgcttgaaggtgga
gtatactttgccgtgtgggctccaaatgccaaagaagtttatgtagaaggtagttttaac
ttttggaataaaaaagaataccctttaagacctaaaggaagctctggcatatgggaaatt
tttatagaagatcttaaaagctatgaactttataagtattacatagtctcaaactttgga
tacgagctagaaaaaagagatccattcgctttttacacagaagtcccaccaaaaagtgcc
ggcatcatttacgatatatctggctatcaatggaaagatgaatcatggcttttaaaaaga
aaaaactcaaaccactacaaagaacccataagcatatacgaagtacatcttggctcttgg
agaaggacgttagaaaacggatttttatcttataaggatatagcccatcagcttgtagag
tatgtaaaagatatgggatttacccatgtagagtttttacccattatggaacatcctttt
tacgggtcttggggatatcaaacgctttcttactttgctccgacatctagatatggagag
ccaaaagattttatgtatcttgtggattttctgcaccaaaacgatataggagtaatactt
gattgggtaccatctcattttgccacagacgattatggactttctttctttgacgggact
catctttacgagcacatggacaaaagaaaaggatatcacccagattggggaagctatata
tttaactatggaagacatgaggttagagcgtttttaataagtagtgccaacttttggttt
gacaaatatcatgtagatggtataagagtagatgccgttgcctccatgctttatcttgat
tattcaagaaaagaaggcgaatgggaaccaaatatttacggtggtaaagaaaatttagaa
gctattgattttctgaggaaactaaatgaaacagtatatatctttaatcctgggatattt
acagtagcagaagaatccaccgcttggcccatggttacaaaacctacttacataggtggg
cttggatttggtttcaaatgggatatgggctggatgcatgatactttgagatatttttcc
aaagacccaatacatagaaaatatcatcaacaagatataacgtttagaatgctttacgct
tttaacgaaaacttcatattaccgctctctcacgatgaggtggtgcatggaaaaggttct
ttgataggaaaaatgcccggtgattactggcaaaaatttgcaaatttaagacttttactg
tcttatatgtatggaagtcctggcaaaaagcttctttttatgggtagtgagtttggccaa
tttgatgaatggaatcacgataaaagcttggactggcatcttttagagtttgattcgcat
aaaggtatacaaaatttggtaagagatttaaataaaatttacaaaaacgaaacagcttta
catgaattagatcacgatccagaaggttttgaatggattgattttcaagacgtagagcaa
tctattttttcatttttaagaaaagccaaaaacggtgatttcgtaatctgtatttttaac
gctactcctgttccaagacatgattataaaataggtgttccaaaaccaggtttttataaa
gaaatattaaattcagactctatctactattggggttctaacgtcggaaatgctggactc
atagaagcgcatgctgaaccttggcataagtttaacttttccataagcttaacgcttcca
ccgttaggagcgctatttttaaaattagcttaa

DBGET integrated database retrieval system