KEGG   Hydrogenobaculum sp. HO: HydHO_0629Help
Entry
HydHO_0629        CDS       T02482                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HydHO_0629
Enzymes [BR:hho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HydHO_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563513..564199
Genome map
AA seq 228 aa AA seqDB search
MYKLLLTREEEKNLESQKIFSSYNINTISLPMIETIPKEFELKGFDFDSIIFSSRKAVEI
FFKNLYICKNTNINIYIVGEKTKESFLKFYNTKKLITRDSIKEILPIISGKTLWIRTDFE
LPEDIKNMVKNKDIFILEAYKTKHKVYDIEKVLEAVNTINGIFFASPSAFLGLLKNLQNY
KYILNEKDIFAIGNTTADAIKNEGFNVTYVPQKPNIESIAKYISSIGT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctgcttctcacaagagaagaagagaagaacttagaatctcaaaaaatattc
tcttcttacaatataaatactatcagcttacctatgatagaaacaataccaaaagagttt
gagttaaaaggctttgactttgacagtataatctttagcagcagaaaagctgtagaaata
ttttttaaaaatttatatatttgcaaaaatacaaatattaatatatatattgtgggagaa
aaaactaaagagtctttcttaaaattttacaacacaaaaaaattaatcactagagattca
ataaaagaaatactacctataataagtggtaaaactctttggataagaacggactttgag
cttccagaagatataaaaaatatggtaaaaaacaaagatattttcatattggaagcctac
aaaactaagcataaggtttacgatatagaaaaggtattagaggctgttaatactataaat
ggaatattttttgctagtccttcagcttttttagggcttttaaaaaatttgcaaaattac
aaatacattttaaacgaaaaagatatatttgccataggaaacactacggcagatgctata
aaaaatgaaggatttaacgtgacttatgtaccacaaaaaccaaacatagaatctatagca
aaatacatatcatctattggcacataa

DBGET integrated database retrieval system