KEGG   Hydrogenobaculum sp. HO: HydHO_0887Help
Entry
HydHO_0887        CDS       T02482                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HydHO_0887
  Amino acid metabolism
   00340 Histidine metabolism
    HydHO_0887
Enzymes [BR:hho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HydHO_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824148..825428
Genome map
AA seq 426 aa AA seqDB search
MITIEDFTIKDFKSSKILEKILNRAKVFEQQYLDKVREIIENVIKYKDEALYKYALEFDN
IDLRKEGIEIPKEAIENAYKELDENTKKALQFSYERVYKFHENQKEKSFITEEEGIMLGQ
RVLPVESAGLYVPGGKAAYPSSVIMNAVPAKVAGVSNIYMVCPKPTKEVLAAAYICGIDR
VFRIGGAQSIAALAYGTETIPAVEKIVGPGNIYVATAKRLVYGIVGIDMIAGPSEVLIIA
DASADPSFVAMDMLSQAEHDELASAILITNCEDLAYSVAKEIDVFLSQLERKDIASKSIE
NYGAIFIVKNLEKACELSNMIAPEHLEINTENPFELLGFIKNAGAIFLGEYTVEALGDYC
LGPNHTLPTGRSARFSSALGVYDFVKRSSVLYVSKKGFDKVKHHAHNLAKAEGLHAHASS
IELRGL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattactattgaagattttacaattaaagattttaaaagctcaaaaatcttagagaag
attttaaacagagctaaggtgtttgaacagcagtatctagataaggtaagagagataata
gaaaacgttataaaatacaaagatgaggctttatataaatacgcccttgagtttgataac
attgaccttagaaaagaaggcatagagataccaaaagaagccatagaaaacgcttacaaa
gagttggatgagaacaccaaaaaggctcttcaattttcttatgaaagggtgtataaattc
catgaaaatcaaaaagagaaatctttcataacagaagaagaaggtataatgttggggcaa
agggtattaccagtagaaagtgcaggtctttatgtaccaggaggcaaagccgcctatcca
tcttctgttattatgaacgcagtgcctgcaaaagtagctggtgtttctaatatttatatg
gtatgtccaaaacccacaaaagaagttttagccgctgcttatatatgtggcatagataga
gtatttagaataggtggagctcaaagtatagcagcattagcttatggcactgagacaata
ccagctgtagaaaagatagtcggccctggtaatatatacgttgccactgcaaaaagattg
gtgtatggcatagtgggcatagatatgatagctggtccttcggaagtgcttattatagcc
gatgcttctgcagatccaagctttgttgccatggatatgctatcccaagctgaacatgat
gaactagctagtgctattttgataacaaactgtgaagatttggcttactcagtggccaaa
gagattgatgttttcttatcacagttagaaagaaaagatatagcctcaaaatctatagaa
aactacggagctatatttatagtaaaaaacttagaaaaagcctgtgaactatccaatatg
atagccccagagcatcttgaaataaatacagaaaacccttttgagcttttaggatttata
aaaaatgccggtgctatattcttaggagagtatacggtggaagctttgggagattattgt
cttggtccaaaccatacgctacctactggaagaagtgcaaggttttcatcggctttaggt
gtttatgattttgtaaaacgctcttcggtgctttacgtgtcaaaaaaaggctttgacaaa
gtaaaacaccatgcccacaaccttgcaaaagccgaaggtcttcacgctcatgcatcctct
atagaattaagaggtttatga

DBGET integrated database retrieval system