KEGG   Hydrogenobaculum sp. HO: HydHO_1061Help
Entry
HydHO_1061        CDS       T02482                                 

Definition
disulfide bond isomerase, DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hho  Hydrogenobaculum sp. HO
Brite
Enzymes [BR:hho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HydHO_1061
Secretion system [BR:hho02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HydHO_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(983573..984358)
Genome map
AA seq 261 aa AA seqDB search
MYKKLLLSIGAFGMIIGSAYAKDACPSKTEVKSILKNFNLPPTIKIEDVYPSKRLSGFCE
VVFKVSPLNAQYFFISKNGNYIIQGQVIDIKHKSLVAPDLSKYEKLSKHQLKELEDHVDF
VYNSKNAKNFVYFITDPQCPFCHEAEGPLKEWAKKNHIAIKVILYPVQTPTGSLHPGSIK
KSAELLCDNNASYSMLEFMYSAPVPKSPCKKGLEKVKENISYLQGLGVDGTPTFVGPTGK
VETGIANSKEAMYKEFGNLIK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaagcttttgttgtctataggtgcttttggtatgattataggcagtgcttat
gcaaaggacgcttgtccatcaaaaacagaggttaaaagcatattgaaaaattttaaccta
ccgcctactataaaaatagaagatgtatatccatccaaaagacttagcggtttttgtgaa
gtggtgtttaaagtatctcctctaaacgctcaatacttttttataagtaaaaacggaaac
tatataatacaaggtcaagtgatagatataaagcataagtctttggtagctccagatcta
tctaagtatgaaaagctatcaaagcatcaactaaaagaattagaagaccatgttgatttt
gtgtacaactctaaaaacgctaaaaactttgtatatttcataacagatcctcaatgtccg
ttttgtcacgaagcggaaggcccgcttaaagaatgggctaagaaaaaccatatagcaata
aaagtaattttatatcctgtacaaacaccaacaggctctttgcatccaggctctattaag
aaatccgctgagcttttatgtgacaacaacgctagttatagcatgctggagtttatgtac
agtgctccggtaccaaaaagcccttgtaaaaaaggtttagaaaaagtaaaggaaaatata
tcatatttgcaaggtttaggagtagatggaacgcctacatttgtgggtcctactggaaaa
gtggaaactggtattgcaaactcaaaagaagcgatgtacaaagagtttggcaatctgata
aaataa

DBGET integrated database retrieval system